KEGG   Rattus norvegicus (rat): 56825Help
Entry
56825             CDS       T01003                                 

Gene name
Cym
Definition
chymosin (EC:3.4.23.4)
Orthology
K01378  
chymosin [EC:3.4.23.4]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.4  chymosin
     56825 (Cym)
Peptidases [BR:rno01002]
 Aspartic Peptidases
  Family A1: pepsin family
   56825 (Cym)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q34
AA seq 379 aa AA seqDB search
MRCFVLLLAVLAIAQSHVVTRIPLHKGKSLRNTLKEQGLLEDFLRRHQYEFSEKNSNIGM
VASEPLTNYLDSEYFGLIYVGTPPQEFKVVFDTGSSELWVPSVYCSSKVCRNHNRFDPSK
SFTFQNLSKPLFVQYGTGSVEGFLAYDTVTVSDIVVPHQTVGLSTEEPGDIFTYSPFDGI
LGLAYPTFASKYSVPIFDNMMNRHLVAQDLFSVYMSRNDQGSMLTLGAIDQSYFIGSLHW
VPVTVQGYWQFTVDRITINDEVVACQGGCPAVLDTGTALLTGPGRDILNIQHAIGAVQGQ
HDQFDIDCWRLNFMPTVVFEINGREFPLPPSAYTNQFQGSCSSGFRHGSQMWILGDVFIR
EFYSVFDRANNRVGLAKAI
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaggtgctttgtgctgctcctcgcggttcttgccatcgcccagagccatgtggtcacc
aggatccctctgcacaaagggaagtctctgaggaacaccctgaaggagcaaggactgctg
gaggactttctgaggagacaccagtatgagttcagtgagaagaactccaacatcgggatg
gtggccagtgagcctctgaccaactatctagatagtgagtacttcggactgatctacgtt
ggaacaccaccccaggagttcaaggtggtgtttgacacaggctcctcagaactctgggtg
ccctctgtgtactgcagcagcaaagtttgcagaaaccacaaccgctttgacccatccaag
tccttcaccttccagaacctgagcaagcccctgtttgtccagtatggtactggcagtgtg
gagggcttcctggcctatgacactgtcacggtctctgacattgtagttccccatcagact
gtgggcctgagtactgaggaaccaggtgacatcttcacctactctccatttgatggcatc
ctgggcctggcctaccctacttttgcctccaagtactcagtacccatatttgacaacatg
atgaacaggcacctggtggcccaagacctgttctccgtttacatgagcaggaatgaccaa
gggagcatgctcacgctgggggccatcgatcagtcctacttcataggctcactgcactgg
gtgcctgtgactgtacaaggatattggcagttcacagtggacaggatcacaatcaatgat
gaggtggtggcttgtcaaggtggctgccctgctgttctggacacaggcactgccctgctg
acagggcctggtagagacatcctcaatattcagcacgccattggagctgtgcagggccaa
catgaccagtttgacattgactgctggaggctgaacttcatgcccacggttgtctttgag
atcaatggtagggagttcccactgccaccctctgcctataccaaccagttccagggctcc
tgctccagtggcttcaggcatggctcccagatgtggatccttggagatgtgttcattcgg
gagttctacagtgtgtttgacagggccaacaatcgtgtcggactggccaaggctatctga

DBGET integrated database retrieval system