KEGG   Rattus norvegicus (rat): 59323Help
Entry
59323             CDS       T01003                                 

Gene name
Erbb4
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 4
  KO
K05085  
receptor tyrosine-protein kinase erbB-4 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
ErbB signaling pathway
Calcium signaling pathway
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    59323 (Erbb4)
   04020 Calcium signaling pathway
    59323 (Erbb4)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    59323 (Erbb4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     59323 (Erbb4)
Protein kinases [BR:rno01001]
 Tyrosine protein kinases
  EGFR family [OT]
   59323 (Erbb4)
Enzyme-linked receptors [BR:rno01020]
 Receptor tyrosine kinases
  RTK class I (EGF receptor family)
   59323 (Erbb4)
Cytokine receptors [BR:rno04050]
 Receptor tyrosine kinase
  RTK class I (EGF receptor family)
   59323 (Erbb4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
UniProt: 
Position
9q32-q33
AA seq 1308 aa AA seqDB search
MKLATGLWVWGSLLVAARTVQPSASQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVM
GNLEITSIEHNRDLSFLRSIREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIF
LNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNMTLVST
IGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSG
PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVD
SSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCT
KINGNLIFLVTGIHGDPYNAIDAIDPEKLNVFRTVREITGFLNIQTWPPNMTDFSVFSNL
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFST
VNQRIVIRDNRRAENCTAEGMVCNHLCSNDGCWGPGPDQCLSCRRFSRGKICIESCNLYD
GEFREFENGSICVECDSQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDVLQGA
NSFIFKYADQDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGG
LFILVIMALTFAVYVRRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKR
VKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASVDHPHL
VRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV
HRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQ
SDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYIVMVKCWMID
ADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAE
EYLVPQAFNIPPPIYTSRTRIDSNRSEIGHSPPPAYTPMSGSQFVYQDGGFATQQGMPMP
YTATTSTIPEAPVAQGATAEMFDDSCCNGTLRKPVVPHVQEDSSTQRYSADPTVFAPERN
PRAELDEEGYMTPMHDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHSASSGPPKAED
EYVNEPLYLNTFTNALGNAEYMKNSLLSVPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQ
EYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTMLPPPPYRHRNTVV
NT seq 3927 nt NT seq  +upstreamnt  +downstreamnt
atgaagctggcgacgggactgtgggtctgggggagccttctggtggcagccaggaccgtc
cagcccagcgcttctcagtcagtgtgtgccggaacagagaacaaactgagctctctctct
gatctggagcagcagtaccgagccttgcgcaaatactatgaaaactgcgaggtagtcatg
ggcaacctggagatcaccagcatagagcacaaccgggacctctccttcctgcggtctatc
cgagaagtcacaggctatgtacttgtggccctcaaccagtttcgttacctgcctctggag
aatttacgcattattcgtgggacaaaactgtatgaagatcgctatgccttagcaatattc
ttaaactacaggaaagatggcaactttggacttcaagaactgggattaaagaacctgacc
gaaatactaaatggtggagtctatgtagaccagaacaaattcctatgttatgctgatact
atacactggcaagatattgttcggaatccatggccttccaacatgactctggtgtcaaca
attggaagttctggatgcggaagatgccataagtcttgcactggtcgatgctggggaccc
acagaaaatcactgccagaccttgacaaggactgtgtgtgcagaacaatgtgatggcagg
tgctatggaccctacgtcagtgactgctgccatcgagaatgtgccggaggctgctcagga
ccaaaagacactgactgctttgcctgcatgaacttcaatgacagtggagcatgtgttact
cagtgtccccaaacgttcgtctacaatccaaccacctttcaactggaacacaacttcaat
gcaaagtacacatatggagcattctgtgttaagaaatgtccacataacttcgtggtagat
tccagttcttgtgtacgagcctgccctagttccaagatggaagtcgaagaaaatggaatt
aaaatgtgtaagccttgcactgatatttgccccaaagcatgtgatggaatcggcaccgga
tccttgatgtctgctcagactgtggattccagtaacattgacaaattcataaactgcacc
aagatcaacgggaatctcatctttcttgtcactggcattcatggggacccttacaatgct
attgacgccatagacccagagaaactgaatgtctttcggacagtcagagaaataacaggt
ttcctgaacatacagacttggcccccaaatatgacagatttcagtgttttctccaacctt
gtaaccattggaggaagagtcctctacagtggtctgtcattgcttatcctcaaacaacaa
ggtatcacttcactacagttccagtctctgaaggaaatcagtgcgggcaatatctacatc
acggacaacagcaacctgtgttattaccacaccatcaactggacaacactgttcagcacc
gttaaccagaggatagtgatccgagacaacaggagggctgagaactgtactgctgaaggg
atggtgtgtaaccacctgtgttcaaatgatggttgttggggacctgggccagaccagtgt
ctgtcatgtcggcgcttcagcaggggaaagatctgtatagagtcctgcaacctttatgat
ggggagtttcgagagtttgaaaatggctccatctgtgttgagtgtgactcccagtgtgag
aaaatggaagacggactcctcacatgccatggaccgggacctgacaactgtacaaagtgt
tctcattttaaagatggtccaaactgtgtagagaaatgtccagatgtcctacagggagca
aacagtttcatatttaagtacgcagatcaggatcgggagtgccacccttgccatccaaac
tgcacccaggggtgtaacggtcccactagtcatgactgcatttactacccatggacgggc
cattccactttaccacaacatgctagaactccactgattgcagccggagtcattggtggg
ctcttcatcctggtcatcatggctctgacatttgccgtttatgtcagaaggaagagcatc
aaaaagaaacgcgctttgagaagattcctggagaccgagttagtcgagcccttaacccct
agtggcacagcacccaatcaagctcaacttcgaattttgaaggaaacagagctaaagagg
gtaaaagtccttggctcgggagcatttggaaccgtttataaaggaatctgggtacctgaa
ggagaaactgtgaaaatccctgtggctattaagatcctcaatgagacaactggccccaaa
gccaatgtggagttcatggatgaggcactgattatggcaagtgtggatcacccacaccta
gtgcgtttactgggtgtgtgtttgagccccactatccagttggttactcagttgatgcca
catggctgcctactggaatatgtccacgaacacaaggataacatcggatcacaactgctg
ttgaactggtgtgtccagattgctaagggaatgatgtatctggaggaaaggcggcttgtt
catcgggatctggcagcccgcaatgtgttggtgaaatctccaaatcatgttaaaatcaca
gactttggactggcccggctcttggaaggagatgaaaaagaatacaatgctgacggtggc
aagatgccaattaaatggatggctctggaatgtatacattataggaaattcacacatcaa
agcgatgtttggagctacggtgtcactatatgggaactgatgacctttggaggaaagccc
tatgatggaattccaacgcgagaaatccctgatttattagagaagggagagcgtttgcct
caacctcccatctgcactattgacgtttacatcgtcatggtcaaatgttggatgatcgat
gctgacagcagacctaaattcaaagaactggctgctgagttttcaaggatggctagagac
cctcaaagatacctagtaattcagggggatgatcgcatgaagcttcccagtccaaacgac
agcaaattcttccagaatctcttggatgaagaggatttggaagatatgatggacgctgag
gaatatttggtcccccaggctttcaatatcccacctcctatctacacatccagaacaaga
attgactccaataggagtgaaattggacacagccctcctcctgcctacacccccatgtcg
ggaagtcagtttgtgtaccaggatgggggtttcgctacacaacaaggaatgcccatgccc
tacacagccacaaccagcaccataccagaggctccagtcgcccagggtgcaacggctgag
atgtttgatgactcctgctgtaatggtaccctgcgaaagccagtggtaccccacgtccaa
gaggacagtagcactcagaggtatagtgccgaccccacagtgttcgccccagaacggaac
ccacgagcagaactggatgaagaaggctacatgactcccatgcatgacaagccaaaacaa
gaatatctgaatcctgtggaagagaacccttttgtgtcccggaggaagaatggagacctt
caagctttagataatccagagtatcacagcgcttccagcggtccccccaaggcagaggat
gagtacgtgaatgagcccctttatctcaacaccttcaccaacgccttgggaaatgcagag
tacatgaaaaacagcttactgtctgtgccagagaaagccaagaaagcatttgacaacccc
gactactggaaccacagcctgccaccccggagcactcttcagcacccagactacctgcag
gaatacagcacaaaatatttttataaacagaatggacggatccgccctattgtggcagag
aatcctgagtacctctcagagttctcgctgaagccaggcactatgctgccccctccgccc
tacagacaccggaatactgtggtgtga

DBGET integrated database retrieval system