KEGG   Rattus norvegicus (rat): 64473Help
Entry
64473             CDS       T01003                                 

Gene name
Bpnt1, Sal3
Definition
3'(2'), 5'-bisphosphate nucleotidase 1 (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    64473 (Bpnt1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     64473 (Bpnt1)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    64473 (Bpnt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q26
AA seq 308 aa AA seqDB search
MASSHNVLMRLVASAYSIAQKAGTIVRCVIAEGDLGIVQKTSATDLQTKADRMVQMSICS
SLSRKFPKLTIIGEEDLPPGEVDQELIEDGQSEEILKQPCPSQYSAIKEEDLVVWVDPVD
GTKEYTEGLLDNVTVLIGIAYEGKAIAGIINQPYYNYQAGPDAVLGRTIWGVLGLGAFGF
QLKEAPAGKHIITTTRSHSNKLVTDCIAAMNPDNVLRVGGAGNKIIQLIEGKASAYVFAS
PGCKKWDTCAPEVILHAVGGKLTDIHGNPLQYDKEVKHMNSAGVLAALRNYEYYASRVPE
SVKSALIP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcttccagccacaatgtgttgatgcggctggtagcctccgcatactctatcgctcag
aaggcaggaaccatcgtcaggtgtgtcatcgctgaaggagacctgggcatcgtgcagaag
acctcagccactgacctgcagaccaaagcagaccgcatggtacagatgagcatatgctct
tccctgtcccggaaattcccgaagctgacgatcatcggggaagaggacctgcctcctgga
gaagtggatcaagaactgattgaagacgggcagtcggaggagatcctgaagcagccgtgc
ccatcgcagtacagtgcaatcaaggaggaagaccttgtggtttgggttgaccccgtagat
ggtaccaaggaatacactgaaggtcttcttgacaatgtaacagtgctcattgggattgct
tatgaaggaaaggccatcgcaggcatcatcaaccagccatattacaactaccaggcagga
ccggacgccgtgctgggcaggaccatctggggagtcctgggtttgggtgcctttgggttt
cagctgaaagaagcccctgctgggaagcacatcatcaccaccaccagatcccatagcaac
aagctggtcacagactgcattgcagccatgaaccctgacaacgtgctgcgagtgggagga
gcaggaaacaagattatccagctgattgaaggcaaagcctctgcttatgtatttgcaagt
cctggatgtaagaaatgggatacttgtgccccagaagttatcttacatgctgtaggaggg
aagttgacagacatccacgggaatcccctgcagtacgacaaggaggtgaaacacatgaac
tctgctggagttctggctgcactgcggaattatgagtactatgcaagccgcgtaccagag
tctgtcaaaagtgcactcattccctga

DBGET integrated database retrieval system