KEGG   Rattus norvegicus (rat): 65044Help
Entry
65044             CDS       T01003                                 

Gene name
C1galt1
Definition
core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1 (EC:2.4.1.122)
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
rno  Rattus norvegicus (rat)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    65044 (C1galt1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     65044 (C1galt1)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  Type 3 chain
   65044 (C1galt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
4q21
AA seq 363 aa AA seqDB search
MASKSWLNFLTFLCGSAIGFFLCSQLLNILLQEQADVQPNMLHNDPHARHSDDSGHNHLK
GQMDFNADSSQHKDENTDVAENLYQKVKVLCWVMTSPQNLEKKAKHVKATWAQRCNKVLF
MSSEENKDFPTVGLETKEGREQLYWKTIKAFQYVHDHYLEDADWFMKADDDTYVILDNLR
WLLSKYNPEQPIYFGRRFKPYVKQGYMSGGAGYVLSKEALRRFVDAFKTEKCTHSSSIED
LALGRCMEIIKVEAGDSRDPTGKETFHPFVPEHHLIKGYLPKTFWYWNYNYYPPVEGPGC
CSDIAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPALPENILKEINQVNKKEDTKIKL
GNP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcctctaaatcttggctgaattttttaactttcctctgtggatcagcaataggattt
ttcttatgttctcaactcttgaatattttgttgcaagaacaggctgacgttcagcctaac
atgcttcataatgatcctcatgccagacattcagacgacagtggacataatcacctcaaa
ggacagatggacttcaatgcagattctagccaacataaagatgagaacacagacgttgct
gagaacctctatcagaaagttaaagttctttgttgggttatgacaagccctcaaaatcta
gagaaaaaggccaaacacgtcaaagctacatgggcccagcgttgtaataaagtgttattt
atgagttcagaagaaaataaagacttccctactgtggggctggaaaccaaagaaggcaga
gagcaactgtactggaaaacaattaaagcgtttcagtacgtacatgaccattacttagaa
gatgctgactggtttatgaaagcagacgatgacacctatgtcatactggacaatctgaga
tggcttctatcaaagtataaccctgaacagcccatttactttgggagaagatttaagccc
tatgtgaagcagggatacatgagtggaggagcaggatatgtcctaagcaaggaagccttg
agaagatttgtggatgcatttaaaacagaaaaatgtacgcacagttcctccattgaagac
ttggccctgggaaggtgcatggagattataaaggtagaagctggagattccagagatccc
actgggaaggaaaccttccacccctttgtaccagaacaccacttaatcaaaggctatctg
ccaaaaacattttggtactggaattacaactactatcctcccgtagagggtcctggttgc
tgttctgatattgcagtttcttttcactatgttgattctacaactatgtatgaattagaa
tacctcgtttatcatcttcgtccatatggttatttatatagatatcaacctgccttacct
gagaatatactaaaagaaattaatcaagtaaacaaaaaggaagatacaaaaataaaatta
ggcaacccctga

DBGET integrated database retrieval system