KEGG   Rattus norvegicus (rat): 691947Help
Entry
691947            CDS       T01003                                 

Gene name
Eif3j, Eif3s1
Definition
eukaryotic translation initiation factor 3, subunit J
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
rno  Rattus norvegicus (rat)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    691947 (Eif3j)
Translation factors [BR:rno03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    691947 (Eif3j)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3q35
AA seq 259 aa AA seqDB search
MAAAAAAAAGDSDSWDADTFSMEDPVRKVAGGGTAGGDRWEGEDEDEDVKDNWDDDDDEN
KEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEESKVLTPEEQLADKLR
LKKLQEESDLELAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASF
LEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDD
LADYGGYDGGYVQDYEDFM
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggcagcgggggactcagactcctgggacgcggacacgttc
tctatggaggacccggttcggaaggtcgcgggcggcggcacagcaggcggggaccgctgg
gaaggcgaggacgaggacgaggacgtgaaggataactgggatgatgatgatgatgaaaat
aaagaagaagcagaagtcaaaccagaagtaaaaatttcagaaaagaaaaaaatagcagaa
aagataaaagagaaagaacggcaacagaaaaaaaggcaagaagaaattaaaaagaggtta
gaagaacctgaagaatctaaagtgctaacacccgaagagcaattagcagataaactccgg
ctaaagaaattacaggaagagtcagaccttgaattagcaaaagaaacttttggtgttaat
aatacagtttatggaatagatgctatgaacccatcttcaagagatgacttcacagagttt
ggaaagttactaaaagataaaattacacaatatgaaaaatcactatattatgccagtttt
ttggaagccttagttcgagatgtctgtatttcattggaaattgatgacttgaaaaagatt
accaactcattgactgtgctctgcagtgaaaaacagaagcaggaaaagcaaagcaaagcc
aaaaagaagaagaaaggtgtggtacctggagggggattaaaggccaccatgaaagacgat
ctggcagactatggtggatatgatggaggatatgtacaagactatgaagacttcatgtga

DBGET integrated database retrieval system