KEGG   Rattus norvegicus (rat): 79240Help
Entry
79240             CDS       T01003                                 

Gene name
Nr4a1, HMR, Ngfi-b, Nur77
Definition
(RefSeq) nuclear receptor subfamily 4, group A, member 1
  KO
K04465  
nuclear receptor subfamily 4 group A member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
PI3K-Akt signaling pathway
Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    79240 (Nr4a1)
   04151 PI3K-Akt signaling pathway
    79240 (Nr4a1)
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    79240 (Nr4a1)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Zinc finger
   Cys4 nerve growth factor IB-like
    79240 (Nr4a1)
Nuclear receptors [BR:rno03310]
 4. Nerve growth factor IB like
  4A. Nerve growth factor IB like receptor
   79240 (Nr4a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q36
AA seq 597 aa AA seqDB search
MPCIQAQYGTPATSPGPRDHLTGDPLALEFSKPTMDLASPETAPTAPATLPSFSTFMDGG
YTGEFDTFLYQLPGTAQPCSSASSTSSSSSSATSPASASFKFEDFQVYGCYPGTLSGPLD
ETLSSSGSDYYGSPCSAPSPPTPNFQPSQLSPWDGSFGHFSPSQTYEGLRVWTEQLPKAS
GPPPPPTFFSFSPPTGPSPSLAQSSLKLFPAPATHQLGEGESYSVPAAFPGLAPTSPNCD
TSGILDAPVTSTKARSGSSGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKSAKY
ICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASP
TNLLTSLIRAHLDSGPNTAKLDYSKFQELVLPRFGKEDAGDVQQFYDLLSGSLDVIRKWA
EKIPGFIELSPGDQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGD
WIDNILAFSRSLHSLGVDVPAFACLSALVLITDRHGLQDPRRVEELQNRIASCLKEHMAA
VAGDPQPASCLSRLLGKLPELRTLCTQGLQRIFCLKLEDLVPPPPIVDKIFMDTLSF
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgccctgtatccaagctcaatatggaacaccagcaaccagcccaggaccgcgtgaccac
ctgacaggtgaccccctggcccttgagttcagcaagcccaccatggacctggccagcccc
gagacggcgcccaccgcacctgccaccctgcccagtttcagcaccttcatggacggcgga
tacaccggagagtttgacaccttcctataccagctgccggggacagcccagccgtgctcc
tcggcctcctccacatcttcttcctcgtcctcggccacctctcccgcgtcggcttccttt
aagtttgaggactttcaggtgtatggctgctaccctggcaccctgagcggcccattagac
gagaccctgtcctccagtggctctgattactatggaagcccctgctcagccccgtcacca
cctacacccaacttccagccatcccagctctccccttgggatggttcatttggccacttc
tcccccagccagacttatgaaggccttcgggtatggactgagcagttgcccaaggcttcc
gggcctccgccacctccaaccttcttctccttcagtcctcccaccggtcccagccccagc
ctggcccagagttccctgaagttgttcccagcaccagccacccaccagctaggggagggg
gagagctattccgtgccagccgctttcccgggcttggcacccacctctccgaactgtgac
acttccggcattctggacgcacccgtaacctccaccaaggcccgcagtgggtcttcaggg
ggcagtgagggccgctgtgctgtctgtggagacaacgcttcgtgccagcattatggggtc
cgcacctgtgagggctgcaaaggcttcttcaagcgcacagtacagaaaagtgccaagtac
atctgcctggcaaacaaggactgccctgtggacaagaggcggcggaaccgctgccagttc
tgtcgcttccagaagtgcctggctgtgggcatggtgaaggaagttgtccggacagacagc
ctaaaggggcggcggggccggctaccttcaaaacccaagcagcccccagatgcctcccct
accaatctcctcacgtccctcattcgagcacatttggactccgggcctaacactgccaag
ttggactattccaagttccaggaactggtgctgccccgctttggaaaggaagatgccggt
gacgtgcagcaattttatgacttgctctctggctccctggacgtcatccggaagtgggcg
gaaaagatcccgggcttcattgagctttccccaggagaccaagacctgttgctagagtcc
gcctttctggagctctttatcctccgcctggcctaccgatctaagcccggtgaggggaag
ctcatcttctgctcaggcctggtgctacaccggctgcagtgtgcccgcggctttggtgac
tggatagacaacattctagccttctcacggtccctgcacagcttgggtgttgatgttcct
gcctttgcctgcctgtctgctctggtcctcatcactgatcgacatggcctccaggaccct
cggcgggtggaggagctgcagaaccgcattgctagctgtctgaaggaacacatggccgcc
gtggcaggagacccacagccggccagctgcctgtcacgtctgctgggcaaactgcctgag
ctccggactctgtgcacccaaggcctacagcgcatcttttgcctcaagctggaggacttg
gtgccccctccacctatcgtggacaagatctttatggacaccttgtctttctga

DBGET integrated database retrieval system