KEGG   Rattus norvegicus (rat): 79240Help
Entry
79240             CDS       T01003                                 

Gene name
Nr4a1, HMR, Ngfi-b, Nur77
Definition
(RefSeq) nuclear receptor subfamily 4, group A, member 1
  KO
K04465  
nuclear receptor subfamily 4 group A member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
PI3K-Akt signaling pathway
Aldosterone synthesis and secretion
Cortisol synthesis and secretion
Cushing's syndrome
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    79240 (Nr4a1)
   04151 PI3K-Akt signaling pathway
    79240 (Nr4a1)
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    79240 (Nr4a1)
   04927 Cortisol synthesis and secretion
    79240 (Nr4a1)
 Human Diseases
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    79240 (Nr4a1)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Zinc finger
   Cys4 nerve growth factor IB-like
    79240 (Nr4a1)
Nuclear receptors [BR:rno03310]
 4. Nerve growth factor IB like
  4A. Nerve growth factor IB like receptor
   79240 (Nr4a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q36
AA seq 597 aa AA seqDB search
MPCIQAQYGTPATSPGPRDHLTGDPLALEFSKPTMDLASPETAPTAPATLPSFSTFMDGG
YTGEFDTFLYQLPGTAQPCSSASSTSSSSSSATSPASASFKFEDFQVYGCYPGTLSGPLD
ETLSSSGSDYYGSPCSAPSPPTPNFQPSQLSPWDGSFGHFSPSQTYEGLRVWTEQLPKAS
GPPPPPTFFSFSPPTGPSPSLAQSSLKLFPAPATHQLGEGESYSVPAAFPGLAPTSPNCD
TSGILDAPVTSTKARSGSSGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKSAKY
ICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASP
TNLLTSLIRAHLDSGPNTAKLDYSKFQELVLPRFGKEDAGDVQQFYDLLSGSLDVIRKWA
EKIPGFIELSPGDQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGD
WIDNILAFSRSLHSLGVDVPAFACLSALVLITDRHGLQDPRRVEELQNRIASCLKEHMAA
VAGDPQPASCLSRLLGKLPELRTLCTQGLQRIFCLKLEDLVPPPPIVDKIFMDTLSF
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgccctgtatccaagctcaatatggaacaccagcaaccagcccaggaccgcgtgaccac
ctgacaggtgaccccctggcccttgagttcagcaagcccaccatggacctggccagcccc
gagacggcgcccaccgcacctgccaccctgcccagtttcagcaccttcatggacggcgga
tacaccggagagtttgacaccttcctataccagctgccggggacagcccagccgtgctcc
tcggcctcctccacatcttcttcctcgtcctcggccacctctcccgcgtcggcttccttt
aagtttgaggactttcaggtgtatggctgctaccctggcaccctgagcggcccattagac
gagaccctgtcctccagtggctctgattactatggaagcccctgctcagccccgtcacca
cctacacccaacttccagccatcccagctctccccttgggatggttcatttggccacttc
tcccccagccagacttatgaaggccttcgggtatggactgagcagttgcccaaggcttcc
gggcctccgccacctccaaccttcttctccttcagtcctcccaccggtcccagccccagc
ctggcccagagttccctgaagttgttcccagcaccagccacccaccagctaggggagggg
gagagctattccgtgccagccgctttcccgggcttggcacccacctctccgaactgtgac
acttccggcattctggacgcacccgtaacctccaccaaggcccgcagtgggtcttcaggg
ggcagtgagggccgctgtgctgtctgtggagacaacgcttcgtgccagcattatggggtc
cgcacctgtgagggctgcaaaggcttcttcaagcgcacagtacagaaaagtgccaagtac
atctgcctggcaaacaaggactgccctgtggacaagaggcggcggaaccgctgccagttc
tgtcgcttccagaagtgcctggctgtgggcatggtgaaggaagttgtccggacagacagc
ctaaaggggcggcggggccggctaccttcaaaacccaagcagcccccagatgcctcccct
accaatctcctcacgtccctcattcgagcacatttggactccgggcctaacactgccaag
ttggactattccaagttccaggaactggtgctgccccgctttggaaaggaagatgccggt
gacgtgcagcaattttatgacttgctctctggctccctggacgtcatccggaagtgggcg
gaaaagatcccgggcttcattgagctttccccaggagaccaagacctgttgctagagtcc
gcctttctggagctctttatcctccgcctggcctaccgatctaagcccggtgaggggaag
ctcatcttctgctcaggcctggtgctacaccggctgcagtgtgcccgcggctttggtgac
tggatagacaacattctagccttctcacggtccctgcacagcttgggtgttgatgttcct
gcctttgcctgcctgtctgctctggtcctcatcactgatcgacatggcctccaggaccct
cggcgggtggaggagctgcagaaccgcattgctagctgtctgaaggaacacatggccgcc
gtggcaggagacccacagccggccagctgcctgtcacgtctgctgggcaaactgcctgag
ctccggactctgtgcacccaaggcctacagcgcatcttttgcctcaagctggaggacttg
gtgccccctccacctatcgtggacaagatctttatggacaccttgtctttctga

DBGET integrated database retrieval system