KEGG   Rattus norvegicus (rat): 81778Help
Entry
81778             CDS       T01003                                 

Gene name
S100a10, p11
Definition
(RefSeq) S100 calcium binding protein A10
  KO
K17274  
calpactin-1 light chain
Organism
rno  Rattus norvegicus (rat)
Brite
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   81778 (S100a10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q31-q34
AA seq 95 aa AA seqDB search
MPSQMEHAMETMMLTFHRFAGEKNYLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLD
QCRDGKVGFQSFLSLVAGLIIACNDYFVVHMKQKK
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgccatcccaaatggagcatgccatggaaaccatgatgcttacatttcacaggtttgca
ggggaaaaaaactacttgacaaaggaggacctgagagtgctcatggaaagggagttccct
gggtttttggaaaatcaaaaggaccctctggctgtggacaaaataatgaaagacctggac
cagtgccgagatggaaaagtgggcttccagagctttctatcactagtggcggggctcatc
attgcatgcaatgactattttgtagtacacatgaagcagaagaagtag

DBGET integrated database retrieval system