KEGG   Rhodococcus opacus B4: ROP_12030Help
Entry
ROP_12030         CDS       T00882                                 

Gene name
xfp
Definition
phosphoketolase (EC:4.1.2.22 4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
rop  Rhodococcus opacus B4
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ROP_12030 (xfp)
Enzymes [BR:rop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     ROP_12030 (xfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1273076..1275478)
Genome map
AA seq 800 aa AA seqDB search
MTEVRQPGSQDSDGHYSDADLESDLRWWAAANYLTVAQIYLQDNTLLREPLRPEHIKPRL
LGHWGTSPGLSMIYALLNRLIRRTDTDCLYVTGPGHGGPALVAATYLEGTYSEVYPGVSR
DAAGIHRLCRQFSTPGGIPSHVSVQTPGSIHEGGELGYALAHAAGAAFDHPNLLVACVIG
DGEAETGPLSASWKLPAFLNPERDGAVLPILHVNGAKIAGPTVHGRSSDADVEAFLGGQG
WAPVVVSGDDPRQVFPALHRALTDAHTAISDLQREARADRRSAAKWPAIVLRTPKGWTGP
RTVDGVLVEGTHRAHQVPLSGVRTNEAHLRQLEEWMRSYGPDQLFDSSGALVPDLVRLAP
QGDKRMGSSPYANGGRLRADLPVPPLEKYALPIEKPGTTHHETTRVLGELLRDLYAATTT
QDGGGYFRLFCPDETSSNRLGAVFEVTDRCWQLPVTDYDDGLAARGRVMEVLSEHLCEGW
LEGYLLSGRHGLFASYEAFAMVSVSMLVQHTKWLQHAVDLPWRAPVASLNVLLTSTCWRN
DHNGFSHQGPGMIDAVIPLAPDVVRVWLPPDSNTLLSIADHCLRSTDHVNLVVVDKQPHL
QYLSLAEAHAHCAAGASVWEWAGTESSAGTEPDVVLAAAGDVPTQEILAAAQLLREHTPE
LVTRVVNVVDLMGLLTPTEHPHGFDARTFLDLFTADTDVVFAFHGYSRAVHELLHGRPAP
DRFHVRGFSEQGTTTTPFDMVVLNRMSRYHLALAALRRTRREPAGATELADHCLRQLERH
GEYVVAHLEDMPEVRDWTWS
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagtacggcagccggggtcgcaggactccgacgggcactattccgacgccgac
ctcgagtcggacctgcggtggtgggcggcggccaactatctgacggttgcgcagatctac
ctgcaggacaacacgcttctgcgtgaaccgctgcgcccggaacacatcaaaccccggctg
ctcgggcactgggggacgagcccggggctgtcgatgatctacgcgctgctgaaccgtctc
atccgccggaccgacacggactgcctgtacgtgaccggtcccggtcacggtggtccggcg
ctcgtcgccgccacgtacctcgagggaacgtactcggaggtgtatccgggcgtgtcccgc
gacgccgccggtatccaccggctgtgccggcagttctcgacgccgggcggcatcccgagt
cacgtcagtgtgcagaccccgggcagcatccacgagggcggcgagctcggctacgcgctc
gcacacgccgccggggcggcattcgaccacccgaatctgttggtggcgtgcgtgatcgga
gacggggaggcggagacgggaccgctgtccgcgtcgtggaaactgcccgcattcctcaac
ccggaacgcgacggtgcggtgctgccgatcctgcacgtcaacggtgcgaagatcgccggg
cccaccgtccacggccgcagcagcgacgccgacgtcgaagcgttcctcggtggtcagggg
tgggcgccggtcgtcgtctccggtgacgatccgcggcaggtcttcccggcgctgcatcgc
gccctgaccgacgcccataccgcgatctccgaccttcagcgggaggcacgggccgaccgg
cgcagcgccgccaagtggccggcgatcgtgctccggacccccaagggctggaccggtccg
cgcaccgtcgacggcgtgctcgtcgagggcacgcaccgggcgcatcaggttccgctgtcg
ggagtccgcaccaacgaggcgcatctgcgtcaactcgaggagtggatgcggtcgtacggc
ccggaccaactgttcgactcgtcgggcgcactcgtgccggacctggtgcggctggcgccg
cagggcgacaagaggatggggtcgtcgccgtacgcgaacggcggccgcctgcgcgcggat
cttcccgtcccgcccctggagaagtacgcgctccccatcgagaaacccggcaccacccac
cacgagaccacccgggtactcggcgaattgctccgcgacctctatgccgccaccaccaca
caagacggcggtggatacttccggctgttctgtcccgacgaaacgtccagcaaccgattg
ggcgccgtcttcgaggtgaccgaccggtgctggcagctgccggtcaccgactacgacgac
ggactggcggcccgcggccgggtgatggaggtgctcagcgagcacctctgcgagggatgg
ctggaggggtacctgctgtcggggcggcacggactgttcgcgagctacgaggccttcgcg
atggtgagcgtgtcgatgctcgtccagcacaccaagtggctgcagcatgcggtggatctg
ccgtggcgggcgccggtggcctcgctgaacgtcctgctcaccagcacctgctggcgcaac
gaccacaacgggttcagccaccaggggccgggcatgatcgacgccgtgatcccgctcgca
ccggatgtggtccgggtgtggctcccaccggactcgaacaccctgctctcgatcgccgac
cactgcctccgcagcaccgatcacgtcaacctcgtcgtggtcgacaaacagccgcacctg
cagtacctgtcccttgcggaggcgcacgcgcactgcgcggccggggcgtcggtgtgggag
tgggcgggaacggagtcttcggcgggcaccgaaccggatgtcgtgctcgctgccgccggg
gacgtcccgacccaggaaattctcgccgccgcgcagttgctgcgcgaacacaccccggaa
ctggtcacccgggtggtcaatgtcgtcgacctgatggggctgctcacgccgaccgagcac
ccgcacggattcgacgcgcgcacattcctcgacctcttcaccgcggacacggacgtggtg
ttcgcgttccacgggtactcgcgcgccgtccacgagttgctacacggacgtcccgcaccg
gaccgcttccacgtccgcggcttcagcgaacagggcactacgaccacaccgttcgacatg
gtcgtgctcaaccggatgagccgataccacctcgcgctcgccgcgctgcgccgcacgcgg
cgggagccggccggtgccacggagttggccgatcactgcctccggcaactcgaacggcac
ggcgaatacgtcgtcgcgcacctcgaggacatgcccgaggtgcgcgactggacgtggtcg
tga

DBGET integrated database retrieval system