KEGG   Pararhodospirillum photometricum: RSPPHO_02672Help
Entry
RSPPHO_02672      CDS       T01851                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rpm  Pararhodospirillum photometricum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSPPHO_02672
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSPPHO_02672
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RSPPHO_02672
Enzymes [BR:rpm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RSPPHO_02672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3202742..3203539
Genome map
AA seq 265 aa AA seqDB search
MSCSSSQDRLAACFARLKAEGRGGLVTYVMAGDPDRESALAVLKGLPGAGADIIELGMPF
SDPMADGPAIQAAALRALKGGMTLAGTLETLGAFRETNTETPVVLMGYYNPVFIYGVEAF
ARDAAQAGADGVILVDVPPEEADEIQPVLRAHGLHLILLATPTSDEARLPTILKNASGFV
YQVSIAGITGAQSAQEDAVRAMIGRIRALSDLPVVVGFGVNTPEQAAAFAKMGDAAVVGS
AIVRHIAEGRDPLAFVADLARAVRA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgagttgctcgtcgtcccaagatcgtctcgctgcctgctttgcccgcctcaaggccgag
gggcgcggcggcctcgtgacctacgtcatggccggggatcccgatcgggagagtgcgctg
gccgtcctgaagggcctgcccggcgccggggctgacattatcgaactcggcatgcccttc
tccgatcccatggccgacggccccgccatccaggccgccgccttgcgcgccctcaagggc
gggatgaccctggccggcaccttggagaccctgggggcgtttcgggagaccaacaccgag
accccggtggtcttgatgggctattacaatcccgtatttatctatggggtcgaggccttc
gctcgcgacgccgcccaggccggggccgatggggtcatcctcgtggacgtgccgcccgag
gaagccgacgagatccagccggtgttgcgcgcccatggcctgcacctgatcttgctggcc
accccgacctcggacgaggcgcgcctgcccaccattctcaagaacgccagcggcttcgtc
tatcaggtgtcgatcgctggcatcaccggcgcccagtcggcgcaggaagacgccgtgcgc
gccatgatcggccggatccgcgccttgagcgatctgccggttgttgtcggctttggtgtc
aacactcccgagcaggcggcggctttcgctaaaatgggggatgccgccgtcgtcggctcg
gccatcgtgcgccatatcgccgaggggcgcgaccctctggcttttgtcgccgatctggcc
cgggcggtgcgggcctag

DBGET integrated database retrieval system