KEGG   Roseiflexus sp. RS-1: RoseRS_3599Help
Entry
RoseRS_3599       CDS       T00542                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs00230  Purine metabolism
rrs01100  Metabolic pathways
Module
rrs_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RoseRS_3599
Enzymes [BR:rrs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RoseRS_3599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 RsgA_GTPase AAA_16 Vir_act_alpha_C NTPase_1 AAA_33
Motif
Other DBs
NCBI-ProteinID: ABQ91954
UniProt: A5UZA1
Position
complement(4496847..4497479)
Genome map
AA seq 210 aa AA seqDB search
MPVVDRNPLLDGLPAYPLLIVISGPSGVGKDSILNRMRELKVPFHFVVTATDRPMREGER
NGYDYHFVTTERFREMISQGELIEWARVYGHYKGIPAFEVRDALASGRDVVLRLDVQGAA
TVRRLAPDSVLIFVAPGSMDELRTRLEQRRTESSAEIDRRLSVAQREMEALEAFDYIVIN
RADRLDEAVAQIQAIVTAEKLRVHPRRVAL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcgttgatcgcaacccgttactcgacggtctgccagcgtacccgctcctgatc
gtcatctccggtccgtctggcgttggcaaagactccatcctgaaccggatgcgtgaactg
aaggtaccgttccattttgtggtcaccgccaccgaccgcccgatgcgcgagggggaacgg
aatgggtacgattatcatttcgtcacaaccgagcgcttccgcgagatgatcagtcagggc
gagttgatcgagtgggcgcgggtctacgggcactacaaaggaattccagcattcgaggtg
cgcgatgcgctggcttcagggcgtgatgtggtgctgcggctcgatgtccagggcgccgca
acggtgcgccgcctggcgcccgattcggtgctgatctttgtggcgccgggaagtatggac
gaactccgtacacgcctcgagcagcgccgcacggagagcagtgcggagatcgaccgccgc
ctgagcgtggcgcaacgcgaaatggaggcgcttgaagcgttcgattatattgtgatcaat
cgcgccgaccgcctggatgaagcagtggcgcagatccaggcgattgtcacggcggagaag
ttgcgtgtgcatccacggcgcgtcgcgctgtag

DBGET integrated database retrieval system