KEGG   Ralstonia solanacearum FQY_4: F504_3589Help
Entry
F504_3589         CDS       T02751                                 

Definition
degradation of polysaccharides
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rse00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    F504_3589
   00500 Starch and sucrose metabolism
    F504_3589
Enzymes [BR:rse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     F504_3589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:complement(120363..121682)
Genome map
AA seq 439 aa AA seqDB search
MGMTPIHGAAVPYLRNAIAFHQLHIPIKQKSLTPGILLTGKITMQSKTLYLKATALLGGC
TVFAATALAVTSTATRPQLSSADARTYTIAKYLASFGTIGSLTTDNWDPTGGVGAVSGFR
ANYAVAADGTAQYKTVQAAIDAAVNAGGVARRYISVKAGTYNELVCVPESAPPITLYGLD
ANAGNTQIVYNNANPTPAAGARTNPCMGTSSNATVGTLRSATAMVRASDFHARNLTFKNS
YVEGTYADNNQSAVALAVRGDKAILENVSVIGNQDTLFVGATSTTTVIRAYFKNSFIQGD
TDFIFGAGTAVFHGCTIQYTAARLGAKAASYIFAPSTAPGNPYGFLAINSTFNATGNPPN
NSLHLGRAWDQSVSGTSAYINGSSPNGQVVIRDSSLGALIRLADPWGPSTAGRPYCSANC
AYSANRFFEYNNTGAGSGN
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgaccccgatccatggcgctgccgttccatacctgcgcaatgccatcgcattc
catcagttgcacatccctatcaaacaaaaaagcctgacaccaggcatccttttgaccgga
aaaataacgatgcaatccaaaaccctgtacttgaaagccaccgcattgctgggaggctgc
accgtgtttgccgcaacggcgctcgccgtgacaagcaccgccacccgccctcagctcagc
agtgccgacgcgcgcacctacaccatcgcgaaatacctggcgagcttcgggacgatcggc
tcgctgaccacggacaactgggaccccaccggcggcgtcggcgcggtgagcggcttccgg
gccaactacgcggtcgcggcggacggaacggcgcagtacaagacggtgcaggccgcgatc
gacgcggcagtcaacgccggcggcgtggcgcgcaggtacatcagcgtgaaggccggcacc
tataacgaactggtctgcgtgcccgagtcggcgccgccgatcacgctgtatggcctcgat
gcgaacgccggcaacacgcagatcgtctacaacaacgcgaacccgacgcccgccgcgggc
gcccggaccaacccctgcatgggcaccagcagcaacgccacggtcggcacgctgcgcagc
gccaccgccatggtgcgggcatcggacttccacgcccgcaacctgaccttcaagaacagc
tacgtggaaggcacctatgccgacaacaaccagtccgcggtagcgcttgccgtgcgcggc
gacaaggccatcctcgaaaacgtctcggtcatcggcaaccaggacacgctgttcgtcggc
gccacgagcaccaccacggtgatccgcgcctacttcaagaacagcttcatccagggcgat
acggatttcatcttcggtgccggcaccgccgtcttccatggctgcacgatccagtacacc
gcggcacgcctgggcgccaaggccgccagctacatctttgcgccgagcacggccccgggc
aatccgtacgggttcctcgccatcaacagcaccttcaacgccaccggcaatccgccgaac
aacagcctgcacctggggcgcgcgtgggatcagagcgtgagcggcacctcggcctacatc
aacggcagctcgcccaatgggcaggtggtgatccgcgattcgtcgctgggcgcgctgatc
cggctggccgatccgtggggcccatcgacggcggggcggccctactgttcggccaactgt
gcgtattcggcgaatcggttctttgagtacaacaacacgggggcgggtagcggcaactga

DBGET integrated database retrieval system