KEGG   Rhodobacter sphaeroides KD131: RSKD131_0976Help
Entry
RSKD131_0976      CDS       T00844                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    RSKD131_0976
Enzymes [BR:rsk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     RSKD131_0976
Exosome [BR:rsk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RSKD131_0976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(981231..982712)
Genome map
AA seq 493 aa AA seqDB search
MNHILAIDQGTTSSRAMVFDEALTLKSVAQEEFPQIYPRPGWVEHDPSDLWSSVAATARA
AVERAEIDGSLAAIGITNQRETVVVWERASGHPIHNAIVWQDRRTADLCHALAEAGHEPT
ITERTGLLLDPYFSATKLKWLLDHVEGARARARRGELLFGTVDSYLIWKLTGGRAHVTDA
TNAARTMLFDIGRGIWDPEICGLLDIPMEMLPEVKDCAALFGMTRADLFGREIPILGVAG
DQQAATCGQACFRPGMMKSTYGTGCFALLNTGEERVTSRARLLTTIAYQLGGKRTYALEG
SIFIAGAVVQWLRDGLKIIREAGETQGLALSSDAAQDLVIVPAFTGLGAPWWKPESRGAV
FGLTRNSGPAEFARAALESVGYQTRDLLEAMRADWAAGAEGVLRVDGGMAASDWSMQFLA
DIIGAPVDRPVVRETTALGVAWLAGMQAGLCPGPEEFAADWALERRFEPQMEASVREAKY
DRWGRAVRAVMAV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacatcctcgccatcgatcagggcaccacctcgtcgcgcgcgatggtcttcgac
gaggccctcacgctgaagtcggtcgcgcaggaggaattcccgcagatctacccgcgcccg
ggctgggtcgagcacgacccctcggacctctggtcgagcgtcgccgccaccgctcgggcg
gcggtcgagcgcgccgagatcgacggcagcctcgcggcgatcgggatcaccaaccagcgc
gaaaccgtcgtcgtctgggagcgtgcctcgggacatccgatccacaatgccatcgtctgg
caggaccggcgcacggccgatctctgccatgccttggccgaagcggggcacgagcccacg
atcaccgagcgcacgggcctgctgctcgatccctatttctcggccaccaagctcaaatgg
ctgcttgatcatgtggagggcgcccgcgcccgcgcgcggcggggcgagcttctgttcggc
acggtggacagctacctgatctggaagctcaccggcgggcgcgcgcatgtgaccgacgcc
accaatgccgcgcgcaccatgctcttcgacatcggccgcggcatctgggacccggagatc
tgcggccttctcgacatcccgatggagatgctgcccgaggtcaaggattgcgcggccctc
ttcggcatgacgcgcgcggatctcttcgggcgtgagatcccgatcctcggcgtggcgggc
gaccagcaggccgccacctgcgggcaggcctgcttccggcccggcatgatgaaatcgacc
tacggcaccggctgctttgcgctgctgaacaccggcgaggagcgggtgacgagccgcgcg
cggctgctgaccaccatcgcctatcagctgggcggcaagcgcacctatgcgctggagggc
tcgatcttcatcgcgggcgccgtggtgcaatggctgcgcgacgggctcaagatcatccgt
gaggcgggcgagacgcagggcctcgccctctcctcggacgcggcgcaggatctggtgatc
gtgcccgccttcaccggcctcggcgcgccctggtggaagcccgagagccgcggcgcggtc
ttcgggctcacccgcaactccggccccgcggaattcgcccgcgcggccctcgaaagcgtg
ggctaccagacccgcgacctgctcgaggcgatgcgggcggactgggcggcgggggccgag
ggcgtgctgcgggtcgatggcgggatggcggcctcggactggtcgatgcagttcctggcc
gacatcatcggcgcgccggtcgaccggccggtggtgcgcgagacgacagcgctcggtgtc
gcgtggctcgcggggatgcaggcggggctctgcccggggccggaggaattcgcggccgat
tgggcgctggagcgacggttcgagccgcagatggaggcgtcggtgcgcgaggcgaaatac
gaccgttggggtcgggccgtgcgcgcggtgatggcggtatga

DBGET integrated database retrieval system