KEGG   Ralstonia solanacearum PSI07: RPSI07_1434Help
Entry
RPSI07_1434       CDS       T01273                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with SdhC
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00020  Citrate cycle (TCA cycle)
rsl00190  Oxidative phosphorylation
rsl00650  Butanoate metabolism
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01130  Biosynthesis of antibiotics
rsl01200  Carbon metabolism
Module
rsl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rsl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPSI07_1434 (sdhD)
   00650 Butanoate metabolism
    RPSI07_1434 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RPSI07_1434 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C MitoNEET_N
Motif
Other DBs
NCBI-ProteinID: CBJ50795
UniProt: D8P1P6
Position
1466187..1466552
Genome map
AA seq 121 aa AA seqDB search
MAQNNIGPKRLVVGAHYGLKDFLAQRVTAVVMAVYTVVLLVAFLLSKDTSYQSWAGLFAN
QWMKLLTFVAFLSLTYHAWIGVRDIWMDYVKPVAVRLTLQVLTILWLVGCAGYAAQILWR
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaaacaatatcggtcccaagcgcctcgtcgtcggcgcacactacggcctgaag
gacttcctcgcgcagcgcgtcaccgccgtggtcatggcggtctacaccgtcgtcctgctg
gtggccttcctgttgtcgaaagacacctcctaccagagctgggctggcctgttcgccaac
cagtggatgaagctgttgacgttcgtcgcattcctgtcgctcacgtatcacgcctggatc
ggcgtgcgcgacatctggatggactacgtgaaacccgtggcagtgcgtttgacgctgcaa
gtgttgacgattctgtggctcgtcggttgcgcgggctacgcagctcagattctctggagg
gtttaa

DBGET integrated database retrieval system