KEGG   Ralstonia solanacearum PSI07: RPSI07_1434Help
Entry
RPSI07_1434       CDS       T01273                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with SdhC (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPSI07_1434 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPSI07_1434 (sdhD)
   00650 Butanoate metabolism
    RPSI07_1434 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RPSI07_1434 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1466187..1466552
Genome map
AA seq 121 aa AA seqDB search
MAQNNIGPKRLVVGAHYGLKDFLAQRVTAVVMAVYTVVLLVAFLLSKDTSYQSWAGLFAN
QWMKLLTFVAFLSLTYHAWIGVRDIWMDYVKPVAVRLTLQVLTILWLVGCAGYAAQILWR
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaaacaatatcggtcccaagcgcctcgtcgtcggcgcacactacggcctgaag
gacttcctcgcgcagcgcgtcaccgccgtggtcatggcggtctacaccgtcgtcctgctg
gtggccttcctgttgtcgaaagacacctcctaccagagctgggctggcctgttcgccaac
cagtggatgaagctgttgacgttcgtcgcattcctgtcgctcacgtatcacgcctggatc
ggcgtgcgcgacatctggatggactacgtgaaacccgtggcagtgcgtttgacgctgcaa
gtgttgacgattctgtggctcgtcggttgcgcgggctacgcagctcagattctctggagg
gtttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system