KEGG   Ralstonia solanacearum PSI07: RPSI07_1446Help
Entry
RPSI07_1446       CDS       T01273                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPSI07_1446 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPSI07_1446 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPSI07_1446 (trpB)
Enzymes [BR:rsl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RPSI07_1446 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1480666..1481859
Genome map
AA seq 397 aa AA seqDB search
MYNLPDAHGHFGPYGGTFVAETLTHALDELRDAYARYQHDPEFIKEYEYELKHFVGRPSP
IYHARRLTEHCGGAQIYLKREDLNHTGAHKVNNVIGQALLARRMGKPRVIAETGAGQHGV
ATATIAARYGMECVVYMGSEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNVADTFYIIGTVAGPHPYPMMVRDFQSVIGEECKVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDHASVQLIGAEAAGEGIETDRHAASLTCGSPGVLHGNRTYLLQDEDGQIIET
HSISAGLDYPGVGPEHAWLKDAGRAQYVGITDQEALQAFHDLCRMEGIIPALESSHALAY
ACKLAPTLPKDKILLVNLSGRGDKDMHTVAEFSGIQL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacctgcctgacgcccacggccacttcggaccctacggcggcaccttcgtcgca
gaaaccctgacccacgcgctggatgaactgcgcgacgcctatgcgcgctaccagcacgat
cccgagttcatcaaggaatacgagtacgagctgaagcatttcgtcggccgtccgtcgccc
atctaccatgcccgccgcctgaccgagcactgcggcggcgcgcagatctacctcaagcgc
gaagacctgaaccacaccggcgcccacaaggtgaacaacgtcatcggccaggcgctgctg
gcgcgccgcatgggcaagccgcgcgtgatcgccgaaaccggcgccggccagcacggcgtg
gccacggccaccatcgccgcgcgctacggcatggaatgcgtggtctacatgggcagcgag
gacgtgcgccgccaggccgccaacgtctatcgcatgaagctgctgggcgcgaccgtggtg
ccggtggaatccggttcgcgcacgctcaaggatgcgctcaacgaagcgatgcgcgactgg
gtgaccaacgtggccgacaccttctacatcatcggcaccgtggctgggccgcacccgtat
ccgatgatggtgcgcgacttccagtcggtgatcggcgaggagtgcaaggtgcagatgccc
gagctggccggtcgccagccggacgccgtgatcgcctgcgtgggcggcggctccaatgcc
atgggcatcttctatccgtacatcgatcacgccagtgtgcagctgatcggcgcggaagcg
gcgggcgagggcatcgagacggaccgccacgccgcgtcgctcacgtgcggttcgccgggc
gtgctgcacggcaaccgcacgtatctgctgcaggacgaggacggccagatcatcgagacg
cattcgatctcggccggcctggactacccgggtgtcggccccgagcatgcctggttgaag
gatgccggccgcgcgcagtatgtcggcatcaccgaccaggaagcgctgcaggccttccac
gacctgtgccgcatggagggcatcatccccgcgctggaatcgagccatgcgctggcctac
gcctgcaagctggcgccgacgctgccgaaggacaagatcctgctggtcaacctgtccggc
cgcggcgacaaggacatgcataccgtcgccgaattctcgggcatccagctctga

DBGET integrated database retrieval system