KEGG   Ralstonia solanacearum Po82: RSPO_c00623Help
Entry
RSPO_c00623       CDS       T02005                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rsn01100  Metabolic pathways
rsn01110  Biosynthesis of secondary metabolites
rsn01130  Biosynthesis of antibiotics
rsn01230  Biosynthesis of amino acids
Module
rsn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RSPO_c00623 (trpC)
Enzymes [BR:rsn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     RSPO_c00623 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEG67925
UniProt: F6FYC1
Position
complement(640820..641623)
Genome map
AA seq 267 aa AA seqDB search
MSDILQKILAVKAEEVAAARKHRDLPSVRAEAEANRHDSTLGPRGFAQALRDKIGAGQAA
VIAEVKKASPSKGVLRPDFKPAEIAGSYAEHGAACLSVLTDEQFFQGHADYLREARAACA
LPVLRKDFMVDLYQVYEARSWGADCILLIVSALDQGLMAELEACTHELGMDVLVEVHDGH
ELDRALRLSTPLVGVNNRNLRTFETTLDTTLGLLKHMPDDRIVVTESGILKPDDVRKMRV
ADVNAFLVGEAFMRADDPGAELARLFA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcctgcagaaaatcctggccgtgaaggccgaagaagtggccgcggcacgc
aagcaccgcgacctgccgagcgtgcgcgccgaggccgaagccaaccgccacgacagcacc
ctgggcccgcgcggctttgcgcaggccctgcgcgacaagatcggcgcgggccaggcggcc
gtgatcgccgaggtcaagaaggcctcgccgtccaagggcgtgctgcgcccggacttcaag
cccgccgagatcgccggcagctatgccgagcacggcgcggcctgcctgtcggtgttgacc
gacgaacagttcttccagggtcacgccgactatctgcgcgaagcccgcgccgcctgcgcg
ctgcccgtgctgcgcaaggacttcatggtcgacctgtaccaggtgtacgaggcccgttcg
tggggtgcggactgcatcctgctgatcgtctccgcgctggatcaggggctgatggccgaa
ctggaagcctgcacgcacgaactcggcatggatgtgctggtggaagtgcacgacggccat
gaactggaccgcgcgctgcgcctgtcgacaccgctggtgggcgtcaacaatcgcaacctg
cgcaccttcgagaccacactcgacaccacgctcggcctgctcaagcacatgccggacgac
cgcatcgtcgtgaccgaatcgggcatcctcaaacccgacgacgtgcgcaagatgcgcgtg
gccgacgtcaacgccttcctggttggcgaggccttcatgcgtgccgacgatccgggcgcc
gaactggcccgcctgttcgcctga

DBGET integrated database retrieval system