KEGG   Rhodobacter sphaeroides 2.4.1: RSP_4050Help
Entry
RSP_4050          CDS       T00284                                 

Gene name
pdhB
Definition
(RefSeq) Dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00010  Glycolysis / Gluconeogenesis
rsp00020  Citrate cycle (TCA cycle)
rsp00620  Pyruvate metabolism
rsp01100  Metabolic pathways
rsp01110  Biosynthesis of secondary metabolites
rsp01120  Microbial metabolism in diverse environments
rsp01130  Biosynthesis of antibiotics
rsp01200  Carbon metabolism
Module
rsp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSP_4050 (pdhB)
   00020 Citrate cycle (TCA cycle)
    RSP_4050 (pdhB)
   00620 Pyruvate metabolism
    RSP_4050 (pdhB)
Enzymes [BR:rsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RSP_4050 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N
Motif
Other DBs
NCBI-GeneID: 3720099
NCBI-ProteinID: YP_352544
UniProt: Q3J3J1
Position
1:complement(1121627..1122955)
Genome map
AA seq 442 aa AA seqDB search
MATEILMPALSPTMEEGTLAKWLKKEGDEVRSGDIIAEIETDKATMEFEAVDEGILGKIL
IAEGTAGVKVNTPIAVLVEEGESVDAVSSAKVPEPQEPADEAAPAQGAPKEAPAPAAKAP
AAQAARSEGERVFASPLARRIAKEKGIDLAAVQGSGPRGRIVKADVEGAQPSAAPAAKAD
AAAPKAEAPAAAAAPVAAPAASAASVAKLFADRDYEEVTLDGMRKTIAARLSEAKQTIPH
FYLRREVALDALMAFRADLNAKLESRGVKLSVNDFIIKACAVALQQVPNANAVWAGDRIL
RLKPSDVAVAVAIEGGLFTPVLRDAHQKSLSALSAEMKDLAARARTKKLAPHEYQGGSFA
ISNLGMFGVENFDAVINPPHGSILAVGAGIRKPVVGKDGAITTATMMSMTLSVDHRVIDG
ALGAEFLKAIVENLENPIAMLA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgagatcctgatgcccgcgctgtctccgacgatggaggaggggacgctcgcg
aaatggctgaagaaggaaggggatgaggtccgctcgggcgacatcatcgccgagatcgag
accgacaaggccaccatggagttcgaggcggtcgacgagggcatcctcggcaagatcctg
atcgccgagggcacggcaggcgtgaaggtcaacacgcccatcgccgtgctggtggaagag
ggcgagagcgtggacgccgtgtcctccgccaaggtgccggagccgcaggaaccggccgac
gaggccgcacccgcgcagggggctccgaaggaggcccctgccccggccgccaaggcgccc
gcggcgcaggcggcccgatccgagggagagcgcgtcttcgcctcgccgctcgcccgccgg
atcgccaaggagaaggggatcgaccttgccgcggtgcagggctcgggcccgcgcggccgg
atcgtgaaggccgatgtcgagggggcgcaaccctcggccgctcccgccgccaaggcggac
gccgcggcaccgaaggcagaagcgcccgccgctgcggccgcgcccgtcgccgcgccggcc
gcctccgcggcttcggtggcgaagctcttcgcggatcgcgactatgaggaagtgaccctc
gacgggatgcgcaagaccattgccgcgcgtctgtccgaggccaagcagaccatcccgcac
ttctacctccggcgcgaggtggctctggatgcgctgatggctttccgcgccgatctcaat
gcgaagctcgagagccggggcgtaaagctctcggtcaacgacttcatcatcaaggcctgt
gcggtggcgctccagcaggtgccgaacgcgaatgccgtctgggccggagaccggatcctg
cggctgaagccctcggacgtggcggtggccgtggcgatcgagggcgggctcttcacgccg
gtcctgcgcgatgcgcaccagaagagcctgtcggcgctgtcggccgagatgaaggatctc
gccgcccgcgcccgcacgaagaagctcgcaccgcacgaatatcagggcggcagcttcgcg
atctcgaacctcggcatgttcggggtcgagaatttcgatgcggtcatcaacccgccgcac
ggctcgatcctcgccgtcggcgcaggcatccgcaagccggtggtgggcaaggacggcgcg
atcacgacggccaccatgatgtcgatgacgctctcggtggaccaccgggtgatcgacggc
gcgctgggggccgagttcctgaaggcgatcgtcgagaatctcgagaacccgatcgccatg
ctggcctga

DBGET integrated database retrieval system