KEGG   Rhodobacter sphaeroides 2.4.1: RSP_4050Help
Entry
RSP_4050          CDS       T00284                                 

Gene name
pdhB
Definition
Dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:rsp01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rsp00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rsp00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rsp00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1121627..1122955)
Genome map
AA seq 442 aa AA seqDB search
MATEILMPALSPTMEEGTLAKWLKKEGDEVRSGDIIAEIETDKATMEFEAVDEGILGKIL
IAEGTAGVKVNTPIAVLVEEGESVDAVSSAKVPEPQEPADEAAPAQGAPKEAPAPAAKAP
AAQAARSEGERVFASPLARRIAKEKGIDLAAVQGSGPRGRIVKADVEGAQPSAAPAAKAD
AAAPKAEAPAAAAAPVAAPAASAASVAKLFADRDYEEVTLDGMRKTIAARLSEAKQTIPH
FYLRREVALDALMAFRADLNAKLESRGVKLSVNDFIIKACAVALQQVPNANAVWAGDRIL
RLKPSDVAVAVAIEGGLFTPVLRDAHQKSLSALSAEMKDLAARARTKKLAPHEYQGGSFA
ISNLGMFGVENFDAVINPPHGSILAVGAGIRKPVVGKDGAITTATMMSMTLSVDHRVIDG
ALGAEFLKAIVENLENPIAMLA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgagatcctgatgcccgcgctgtctccgacgatggaggaggggacgctcgcg
aaatggctgaagaaggaaggggatgaggtccgctcgggcgacatcatcgccgagatcgag
accgacaaggccaccatggagttcgaggcggtcgacgagggcatcctcggcaagatcctg
atcgccgagggcacggcaggcgtgaaggtcaacacgcccatcgccgtgctggtggaagag
ggcgagagcgtggacgccgtgtcctccgccaaggtgccggagccgcaggaaccggccgac
gaggccgcacccgcgcagggggctccgaaggaggcccctgccccggccgccaaggcgccc
gcggcgcaggcggcccgatccgagggagagcgcgtcttcgcctcgccgctcgcccgccgg
atcgccaaggagaaggggatcgaccttgccgcggtgcagggctcgggcccgcgcggccgg
atcgtgaaggccgatgtcgagggggcgcaaccctcggccgctcccgccgccaaggcggac
gccgcggcaccgaaggcagaagcgcccgccgctgcggccgcgcccgtcgccgcgccggcc
gcctccgcggcttcggtggcgaagctcttcgcggatcgcgactatgaggaagtgaccctc
gacgggatgcgcaagaccattgccgcgcgtctgtccgaggccaagcagaccatcccgcac
ttctacctccggcgcgaggtggctctggatgcgctgatggctttccgcgccgatctcaat
gcgaagctcgagagccggggcgtaaagctctcggtcaacgacttcatcatcaaggcctgt
gcggtggcgctccagcaggtgccgaacgcgaatgccgtctgggccggagaccggatcctg
cggctgaagccctcggacgtggcggtggccgtggcgatcgagggcgggctcttcacgccg
gtcctgcgcgatgcgcaccagaagagcctgtcggcgctgtcggccgagatgaaggatctc
gccgcccgcgcccgcacgaagaagctcgcaccgcacgaatatcagggcggcagcttcgcg
atctcgaacctcggcatgttcggggtcgagaatttcgatgcggtcatcaacccgccgcac
ggctcgatcctcgccgtcggcgcaggcatccgcaagccggtggtgggcaaggacggcgcg
atcacgacggccaccatgatgtcgatgacgctctcggtggaccaccgggtgatcgacggc
gcgctgggggccgagttcctgaaggcgatcgtcgagaatctcgagaacccgatcgccatg
ctggcctga

DBGET integrated database retrieval system