KEGG   Rickettsia slovaca D-CWPP: MC3_07475Help
Entry
MC3_07475         CDS       T01801                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rsw  Rickettsia slovaca D-CWPP
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:rsw00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MC3_07475
   00240 Pyrimidine metabolism
    MC3_07475
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MC3_07475
   03430 Mismatch repair
    MC3_07475
   03440 Homologous recombination
    MC3_07475
Enzymes [BR:rsw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     MC3_07475
DNA replication proteins [BR:rsw03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     MC3_07475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1256374..1256838)
Genome map
AA seq 154 aa AA seqDB search
MQQFSIYQTSDELLLKSILLLIEKCYHSDLKSVILTADADQQEMLNKNLWTYSRKQFIPH
GSKLDPQPEKQPIYITDELQNPNNASVLVIISPTDIGKILQAKEYIRVFKRIIIITDLPE
DLKELTVKINKFTGQENKIDCFTQNPRGAWNKVV
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaatttagtatttatcaaacaagcgatgaattgcttctaaaatcgatattgctt
ctgatagaaaaatgctatcactctgatcttaaaagcgtgatattaactgcagatgcagat
caacaagaaatgctcaataaaaatctttggacttattcacgtaagcaatttatacctcac
ggtagtaaacttgacccgcagcctgaaaaacagccgatttatattaccgatgagttacaa
aatcctaataatgctagtgtgcttgttattatttcgcctacagatataggaaaaatttta
caagcaaaagagtatataagagttttcaaaaggataattataataactgatttaccggaa
gatttaaaagaattaacagttaaaataaataaatttaccggacaggaaaacaaaatagat
tgttttactcaaaatcctcgtggagcttggaataaagtagtctaa

DBGET integrated database retrieval system