KEGG   Ramlibacter tataouinensis: Rta_27290Help
Entry
Rta_27290         CDS       T01544                                 

Gene name
dcyD
Definition
D-cysteine desulfhydrase
Orthology
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
rta  Ramlibacter tataouinensis
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:rta00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2903175..2904191
Genome map
AA seq 338 aa AA seqDB search
MKLAKFPRIRLGHMPTPLEPMKNLSAALGGPNLWIKRDDCTGLATGGNKTRKLEFLMADA
LAQGADTVITQGATQSNHARQTVAAAVRLGMQSHIILEDRTGYTDPEYKQSGNVFLDQLM
GASVSEVPGGSDMDAAMRRLADELRSRGRKPYIIPGGGSTPIGALGYVACALELAEQAYG
LGLDIHTLVHATGSAGTQAGLVAGMEGARTQIPVLGIGVRAPRPAQEDRVYSLAQQTAEL
IGVPGAVARDKVVANCDYVGKGYGLPTDSMAEAVALVARTEGILLDPVYSGKGMAGLIDL
VRKGHFRKGQDVVFLHTGGSVALYGYRSVFASLKPATA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgcgaaattcccccgcatccggctcggccacatgcccacgccgctggagccg
atgaagaacctcagcgccgcgctgggcggccccaacctgtggatcaagcgggacgactgc
accggcctggccaccggcggcaacaagacccgcaagctcgagttcctcatggccgatgca
ctcgcccagggcgccgacaccgtcatcacccagggcgccacccagtccaaccacgctcgc
cagaccgtggcggccgcggtccggctgggcatgcaaagccacatcatcctggaggaccgc
accggctacaccgacccggagtacaagcagtcgggcaacgtcttcctcgaccagctcatg
ggcgcctcggtgagcgaagtcccggggggcagcgacatggacgccgccatgcggcggctg
gccgacgagctgcgcagccgcggccgcaagccctacatcatccccggcgggggctccacg
cccatcggcgcgctgggctacgtggcgtgcgcgctggagctggccgagcaggcctacggc
ctggggctggacatccacacgctggtgcacgccaccggcagcgccggcacgcaggccggc
ctggtggcggggatggaaggcgctcgcacgcagatcccggtgctgggcatcggcgtgcgc
gcaccccggccggcgcaggaggacagggtgtactcgctcgcgcagcagacggccgagctg
atcggcgtgccgggcgcggtggcgcgcgacaaggtggtcgccaactgcgattacgtgggc
aagggctacggcctgcccaccgattcgatggccgaggccgtggccctggtggcgcgcacc
gagggcatcctgctggacccggtgtactccggcaagggcatggcgggcctgatcgacctg
gtgcgcaaggggcacttcaggaaggggcaggacgtggtgttcctccacaccggcggctcg
gtggccctgtacggctaccgctccgtcttcgccagcctcaagccggccacggcctga

DBGET integrated database retrieval system