KEGG   Ramlibacter tataouinensis: Rta_27290Help
Entry
Rta_27290         CDS       T01544                                 

Gene name
dcyD
Definition
D-cysteine desulfhydrase
Orthology
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
rta  Ramlibacter tataouinensis
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rta_27290 (dcyD)
Enzymes [BR:rta01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.25  L-cysteate sulfo-lyase
     Rta_27290 (dcyD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2903175..2904191
Genome map
AA seq 338 aa AA seqDB search
MKLAKFPRIRLGHMPTPLEPMKNLSAALGGPNLWIKRDDCTGLATGGNKTRKLEFLMADA
LAQGADTVITQGATQSNHARQTVAAAVRLGMQSHIILEDRTGYTDPEYKQSGNVFLDQLM
GASVSEVPGGSDMDAAMRRLADELRSRGRKPYIIPGGGSTPIGALGYVACALELAEQAYG
LGLDIHTLVHATGSAGTQAGLVAGMEGARTQIPVLGIGVRAPRPAQEDRVYSLAQQTAEL
IGVPGAVARDKVVANCDYVGKGYGLPTDSMAEAVALVARTEGILLDPVYSGKGMAGLIDL
VRKGHFRKGQDVVFLHTGGSVALYGYRSVFASLKPATA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgcgaaattcccccgcatccggctcggccacatgcccacgccgctggagccg
atgaagaacctcagcgccgcgctgggcggccccaacctgtggatcaagcgggacgactgc
accggcctggccaccggcggcaacaagacccgcaagctcgagttcctcatggccgatgca
ctcgcccagggcgccgacaccgtcatcacccagggcgccacccagtccaaccacgctcgc
cagaccgtggcggccgcggtccggctgggcatgcaaagccacatcatcctggaggaccgc
accggctacaccgacccggagtacaagcagtcgggcaacgtcttcctcgaccagctcatg
ggcgcctcggtgagcgaagtcccggggggcagcgacatggacgccgccatgcggcggctg
gccgacgagctgcgcagccgcggccgcaagccctacatcatccccggcgggggctccacg
cccatcggcgcgctgggctacgtggcgtgcgcgctggagctggccgagcaggcctacggc
ctggggctggacatccacacgctggtgcacgccaccggcagcgccggcacgcaggccggc
ctggtggcggggatggaaggcgctcgcacgcagatcccggtgctgggcatcggcgtgcgc
gcaccccggccggcgcaggaggacagggtgtactcgctcgcgcagcagacggccgagctg
atcggcgtgccgggcgcggtggcgcgcgacaaggtggtcgccaactgcgattacgtgggc
aagggctacggcctgcccaccgattcgatggccgaggccgtggccctggtggcgcgcacc
gagggcatcctgctggacccggtgtactccggcaagggcatggcgggcctgatcgacctg
gtgcgcaaggggcacttcaggaaggggcaggacgtggtgttcctccacaccggcggctcg
gtggccctgtacggctaccgctccgtcttcgccagcctcaagccggccacggcctga

DBGET integrated database retrieval system