KEGG   Rubrobacter xylanophilus: Rxyl_0125Help
Entry
Rxyl_0125         CDS       T00368                                 

Definition
NADH dehydrogenase (quinone) (EC:1.6.99.5)
Orthology
K05903  
NADH dehydrogenase (quinone) [EC:1.6.99.5]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Oxidative phosphorylation
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:rxy00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(129465..131288)
Genome map
AA seq 607 aa AA seqDB search
MILAATAILAPLAAAALILALRRLPAALALAGTGAGLAASAATLLRVAGGASLSATLPGL
PGLPLRLLAEPLTALLSAVVAVVGFFVVVYAVGYMEGEGGRVRFFAGMSFFVAAMQALVL
AGDWVLLLAAWELIGLSSYLLIGHRHEREGVPQAATRAFLYTRTADLGLYAAIFVLVAHA
GTSEISPTLQTGGTAATAAGLLLLVAAMGKSAQTPLQGWLQDAMVGPTPVSALLHSATLV
AAGAILMIRTSPLLPPAVLLLAGLAGGATALLAGLVALAERDLKRLLAASTSAQYGLMLL
AVGAGSPVAALVHLAAHAAIKSALFLGSGVFQHARGSTRLDRLEGAGRARPRTFLGFAVA
GLALAGVPPLSGYFTKDAILAAAFGSPYAPLLAPLALAGTLLTGAYVARALGLLWRGAGA
GGPVKGARWMGAGLAALALLAAALGLAVPPIGELLARQELPEGALATVAGLAATLGGLAL
GWLVPEDRMLGPLRAPAERGFRPGGGLDALVARPALALGRAAARFDDGVVHAAVLSAGRA
ALAVAAASRLTDERGIDALVLSLARGTRRLGGRARELQTGLVHRELLLAAGGAALMLVVL
TIGAAGT
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgccgccaccgcgatcctcgcgccgctcgcggccgccgccctgatcctcgcc
ctccgccgcctcccggcggcgctggccctcgcggggacgggcgccgggcttgcggcctcg
gcggcgacgctcctccgggtggcaggcggcgcgtccctctccgcgacgctcccggggctg
ccgggcctgccgctgcggcttctcgccgagcccctcaccgccctgctctcggcggtcgtc
gcggtcgtggggttcttcgtggtggtctacgcggtcgggtacatggagggcgaggggggc
cgcgtgcgcttcttcgccggcatgtcgttcttcgtggcggcgatgcaggcgctcgtgctc
gcgggggactgggtgctgctgctcgccgcctgggagctgatcgggctgagcagctacctc
ctgatcgggcaccggcacgagcgcgagggcgtgccgcaggccgcgacccgcgccttcctc
tacacccgcaccgccgacctcgggctctacgcggcgatcttcgtcctcgtcgcgcacgcg
ggcaccagcgagatctcccccaccctccagacgggcgggacggcggcgaccgccgccggg
ctcctgctcctcgtggccgcgatgggcaagtccgcccagacccccctgcagggctggctg
caggacgcgatggtcggtcccacccccgtctcggcgctgctgcactcggccacgctcgtc
gccgccggggcgatcctcatgatccggacctcccccctcctcccgcccgccgtgctcctc
ctcgcgggcctcgcaggcggcgcgaccgcgctgctcgccggcctcgtcgccctcgccgag
cgcgacctgaagcggctgctcgccgcctccacctccgcccagtacggcctgatgctgctg
gcggtcggcgcgggttcacccgtggccgccctcgtccacctcgccgcccacgccgcgata
aagagcgcgctcttcctcggctccggcgtcttccagcacgcccgcggctccacgcggctc
gaccggctggagggggcggggcgcgcccgcccgcggaccttcctcggcttcgccgtcgcg
gggctcgccctcgccggcgtgccgcccctgagcgggtacttcacgaaggacgcgatcctc
gccgccgccttcgggtcgccctacgcccccctcctcgccccgctcgccctcgccgggacg
ctgctgaccggcgcctacgtggcgcgggcgctcgggcttctctggcgcggcgcgggcgcg
ggcggccccgtcaagggcgcacgctggatgggggcggggctcgccgccctcgccctcctc
gccgccgctctggggcttgcggtgccgcccatcggggagctcctggcccgtcaggagctc
ccggagggcgcgctcgccacggtcgcggggctcgcggcgacgctcggcggcctggccctg
gggtggctcgtcccggaggaccggatgctcggtccgctgcgcgccccggcggagaggggg
ttccgccccggcggcggcctcgacgcgctcgtcgcgaggccggcgctcgcgctcgggcgc
gccgccgcgcgcttcgacgacggcgtcgtacacgccgccgtgctctccgccgggcgggcc
gccctcgcggtcgccgccgcctcgcgcctgaccgacgagcgggggatagacgccctggtc
ctctccctggcgcggggcacccggaggctcggagggcgcgctcgcgagctgcagaccggc
ctcgtccacagggagctcttgctcgccgcgggcggggcggccctgatgctcgtggtcctg
accatcggcgcggcaggcacctag

DBGET integrated database retrieval system