KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_2121Help
Entry
NWMN_2121         CDS       T00557                                 

Gene name
truA
Definition
tRNA pseudouridine synthase A (EC:5.4.99.12)
Orthology
K06173  
tRNA pseudouridine38-40 synthase [EC:5.4.99.12]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2358145..2358948)
Genome map
AA seq 267 aa AA seqDB search
MRILVEIAYQGNNFLGFQIQQNGRTVQQQFEKLLQRMHKRHVRIHPSSRTDRGVHAIQQY
FHFDTELNIPMSQWQYAMNRTLPDDIYVNNVVTVDDDFHCRYDCVGKRYRYKVYQAQHRD
PFQSGLKTFIPETLDLGKMNRAAQQFIGTHDFTGFCSQKTEVESKVRTLYQSEIVKTDDG
FDYIVTGSGFLYNMVRVLVAFLIEVGKGRHEVSDVPKLLESKNRKNVPFTAPAEGLYLEK
IYLDENELLKDFGNDIKIHRKKSLQND
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatattagtagaaattgcgtatcaaggaaataattttctaggttttcaaattcaa
caaaatggtcgaacggtacagcaacaatttgaaaagctattacaacgcatgcataaaaga
catgtgagaatccatccttcaagtaggactgatagaggtgtacatgcgatacagcaatac
tttcatttcgacacagagctgaatatacctatgtcacaatggcaatatgcaatgaaccga
acgttacctgatgatatttatgtcaacaatgtagttacagtcgatgacgattttcattgt
cgttatgattgtgtaggtaaacgttatcgctacaaagtatatcaagcacaacaccgcgat
ccatttcaaagtggtttgaaaacatttattcctgaaacgttggatttaggtaaaatgaac
agagcggcgcaacaattcataggtacacatgattttacgggattttgttcgcaaaaaact
gaagtagaaagcaaagttagaacattataccaaagtgaaatcgtaaagacagatgatggc
tttgattatattgtcactggatctggatttttatataacatggtgcgtgtcttagttgca
tttttaatagaagttggaaaagggcgacatgaagtatctgatgtaccaaaacttcttgaa
tcaaagaatcgtaagaatgtacctttcactgcaccggctgaaggattatatttagagaaa
atttatttagatgaaaatgagttattaaaagactttggtaacgatatcaaaatacatcgt
aaaaaatcattacaaaatgactga

DBGET integrated database retrieval system