KEGG   Streptomyces albus: XNR_0371Help
Entry
XNR_0371          CDS       T02545                                 

Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
salb  Streptomyces albus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:salb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    XNR_0371
Enzymes [BR:salb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     XNR_0371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(446456..447373)
Genome map
AA seq 305 aa AA seqDB search
MQEEHAGHDLLVVGSANADLVIGVERRPAPGETVLGSDLAVHPGGKGGNQAVAAARLGAR
TALLARVGDDAHGRLLLDAQRAAGTDTTGVLVGGAPTGVALITVDPSGDNSIVVSPGANA
RLTPADVRAAAPLVAGARVVSTMLEIPLETVAELTAVLPAGGRLVLNPSPPAPLPAGVLA
ACDPLVVNEHEARFILGEQAGELPEEWARGLLALGPRSVVVTLGAEGALVADGAGAESTR
VPSLKVEAVDTTGAGDAFTAALAWRLGLGESLVEAARYAVRVGAAAVTRPGAQASYPTAE
EVPAP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggaagagcacgcgggccacgacctgctggtcgtcggttcggccaacgccgacctg
gtgatcggcgtcgagcgcaggccggcccccggcgagacggtgctcggctccgacctcgcc
gtccaccccggcggcaagggcggcaaccaggccgtcgccgccgcccgcctgggcgcccgt
acggcgctgctggcgcgggtcggcgacgacgcccacggccggctgctgctcgacgcgcag
cgcgcggccggcaccgacaccaccggggtgctggtcggcggggcccccaccggggtcgcc
ctgatcaccgtggacccctcgggcgacaacagcatcgtcgtctccccgggggccaacgcc
cggctcaccccggccgacgtccgggccgccgcgcccctggtggccggtgcccgggtggtc
tctaccatgctggagatcccgctggagacggtggcggagctgacggcggtcctgcccgcc
ggggggcggctggtgctcaacccgtcgccgcccgcgccgctgcccgccggggtgctggcc
gcctgcgacccgctggtggtcaacgagcacgaggcccggttcatcctgggcgagcaggcg
ggtgagctgcccgaggagtgggcgcgggggctgctggccctcggcccgcgctcggtggtc
gtcactctcggcgccgaaggcgcgctggtcgccgacggcgccggtgcggagtccacgcgc
gtgccgagcctcaaggtcgaggcggtcgacaccaccggcgcgggcgacgccttcacggcc
gccctcgcctggcggctcggcctcggcgaaagcctggtcgaggcggcccggtacgcggtg
cgggtcggcgccgccgccgtcacccggcccggcgcccaggcctcgtacccgaccgccgag
gaggtgccggccccgtga

DBGET integrated database retrieval system