KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_1679Help
Entry
Sulac_1679        CDS       T01746                                 

Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Sulac_1679
Enzymes [BR:sap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Sulac_1679
Transfer RNA biogenesis [BR:sap03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Sulac_1679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1648123..1648905
Genome map
AA seq 260 aa AA seqDB search
MNPTDWANRLEPALAAAERLILAVYERAEIPRRLKADQSPVTEADHGSSQILVEALRRLT
PEIPVISEEAEWSGESVPRFWVIDPLDGTKEFIAHRGEFTMNLALIDGGKPVWGLIAVPL
SGRRYVAWDRQAYRVEPDGSWHRLNPLMPPHNGLRVAASHSHPELVRAWCREQAVPIREL
REAGSALKFVWMAEGEIDIYPRLKPTMAWDTAAGQVLVESLGGHVLRWPLGTSLTYYSDQ
MVNPSFVASTPGVPVKFVGN
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccacggattgggctaatcggctggagccggctctggccgcagccgaacggttg
attctggccgtctatgaaagggcggagataccccgccggttgaaagccgaccaatcgccg
gttacggaagccgatcacgggtccagccagattctggtcgaggctttacggcggttaaca
cccgagatcccggtgatttcggaggaagccgaatggtcaggggaatccgtgccgcggttt
tgggtcatcgatccgctggacgggacgaaagaatttatcgcccatcgcggcgaatttacg
atgaatctcgccttgatcgacggcggcaaaccggtgtggggcctgattgccgtgcccctt
agcggccgccgctatgtggcttgggatcggcaagcctatcgggtggagccggacgggtct
tggcaccggctcaacccgttaatgcctccgcacaacggacttcgggtggcggccagtcat
agccatccggagttggtccgggcctggtgtcgagagcaggcggtcccgatacgggaattg
cgagaagccgggagtgccttaaagttcgtgtggatggccgaaggcgaaattgatatttat
ccccggctgaaacccaccatggcttgggatacggccgccggtcaagttctggtggaaagc
ctcggaggccacgttctgcgttggccgttaggcacctcgttgacctattattcggatcag
atggttaacccgtcatttgtggccagtactcctggcgtccccgtgaagtttgtgggaaat
taa

DBGET integrated database retrieval system