KEGG   Salinispora arenicola: Sare_0402Help
Entry
Sare_0402         CDS       T00613                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
saq  Salinispora arenicola
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sare_0402
   01230 Biosynthesis of amino acids
    Sare_0402
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sare_0402
  Energy metabolism
   00680 Methane metabolism
    Sare_0402
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sare_0402
Enzymes [BR:saq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Sare_0402
Exosome [BR:saq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Sare_0402
  Exosomal proteins of melanoma cells
   Sare_0402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
463329..464096
Genome map
AA seq 255 aa AA seqDB search
MTASEGPTVGTLVLLRHGESDWNAKNLFTGWVDVDLTGKGETEARRGGELLREHNLLPDV
VHTSLLRRAIRTAELALETAERNWIAVRRSWRLNERHYGALQGKNKKQTLDEYGEEQFML
WRRSYDTPPPPIADDDEWSQVGDPRYRLLPTELMPRTECLKDVVERMLPYWYDSIVPDIL
AGRTVLVAAHGNSLRALVKHLDQISDEAIAKLNIPTGIPLRYDLDPQLRPMTLGGTYLDP
TAARDAAAAVANQGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgactgctagtgaggggcccaccgtcgggacgctggtcctgctacgacacggtgagagc
gactggaacgccaagaacctcttcaccggctgggtcgacgtggacctgaccggcaagggg
gagaccgaggcgcgtcgcggcggtgagctgctgcgtgagcacaacctgttgccggacgtg
gtgcacaccagcctgcttcgccgggcgatccgcaccgcggaactggcgctggagaccgcc
gaacggaactggatcgcggtacgtcgctcctggcggctcaacgagcgccactacggcgcc
ctgcagggcaagaacaagaagcagacgctcgacgagtacggcgaggagcagttcatgctc
tggcgtcgctcgtatgacacaccgccacctccgatcgcggacgacgacgaatggtcgcag
gtcggagacccgcgctaccggctgttgccgaccgagctgatgccgcggacggagtgcctg
aaggacgtcgtggagcggatgctgccgtactggtacgactcgatcgtgccggacatcctg
gctggccggacggtgctggtggccgcgcacggcaactcgttgcgtgccctggtgaagcac
ctggaccagatcagtgacgaggccatcgcgaagctgaacattccgacgggcatcccgctg
cgctacgacctcgatccgcagttgcgcccgatgacactcggtggcacctacctggacccg
acagcggcacgcgatgccgctgcggcggtggcgaaccagggccgctga

DBGET integrated database retrieval system