KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA0729Help
Entry
SA0729            CDS       T00051                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SA0729 (tpiA)
   01230 Biosynthesis of amino acids
    SA0729 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SA0729 (tpiA)
   00051 Fructose and mannose metabolism
    SA0729 (tpiA)
   00562 Inositol phosphate metabolism
    SA0729 (tpiA)
Enzymes [BR:sau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SA0729 (tpiA)
Exosome [BR:sau04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SA0729 (tpiA)
  Exosomal proteins of bladder cancer cells
   SA0729 (tpiA)
  Exosomal proteins of melanoma cells
   SA0729 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Structure
PDB: 

Jmol
Position
835146..835907
Genome map
AA seq 253 aa AA seqDB search
MRTPIIAGNWKMNKTVQEAKDFVNALPTLPDSKEVESVICAPAIQLDALTTAVKEGKAQG
LEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFK
HGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEDQLKSVVIAYEPIWAIGTGKSS
TSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASL
KVEDFVQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccaattatagctggtaactggaaaatgaacaaaacagtacaagaagcaaaa
gacttcgtcaatgcattaccaacattaccagattcaaaagaagtagaatcagtaatttgt
gcaccagcaattcaattagatgcattaactactgcagttaaagaaggaaaagcacaaggt
ttagaaatcggtgctcaaaatacgtatttcgaagataatggtgcgttcacaggtgaaacg
tctccagttgcattagcagatttaggcgttaaatacgttgttatcggtcattctgaacgt
cgtgaattattccacgaaacagatgaagaaattaacaaaaaagcgcacgctattttcaaa
catggaatgactccaattatttgtgttggtgaaacagacgaagagcgtgaaagtggtaaa
gctaacgatgttgtaggtgagcaagttaagaaagctgttgcaggtttatctgaagatcaa
cttaaatcagttgtaattgcttatgagccaatctgggcaatcggaactggtaaatcatca
acatctgaagatgcaaatgaaatgtgtgcatttgtacgtcaaactattgctgacttatca
agcaaagaagtatcagaagcaactcgtattcaatatggtggtagtgttaaacctaacaac
attaaagaatacatggcacaaactgatattgatggggcattagtaggtggcgcatcactt
aaagttgaagatttcgtacaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system