KEGG   Shewanella baltica BA175: Sbal175_0494Help
Entry
Sbal175_0494      CDS       T02014                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00010  Glycolysis / Gluconeogenesis
sbb00020  Citrate cycle (TCA cycle)
sbb00620  Pyruvate metabolism
sbb01100  Metabolic pathways
sbb01110  Biosynthesis of secondary metabolites
sbb01120  Microbial metabolism in diverse environments
sbb01130  Biosynthesis of antibiotics
sbb01200  Carbon metabolism
Module
sbb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal175_0494
   00020 Citrate cycle (TCA cycle)
    Sbal175_0494
   00620 Pyruvate metabolism
    Sbal175_0494
Enzymes [BR:sbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sbal175_0494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 Peptidase_M23 RnfC_N PYNP_C HlyD_3
Motif
Other DBs
NCBI-ProteinID: AEG09789
UniProt: G0AUV5
Position
559879..561876
Genome map
AA seq 665 aa AA seqDB search
MAELKEVFVPDIGGDEVQVIEICVAVGDTLAAEESILTVESDKATMDIPAPFAGVLAELK
VAVGDKVSEGTLIAMMQAAGAAAAAPAPVAAPAQAAPASAPVQAAPAPVAAAPATGATKV
VEVTVPDIGGDTDVSVIEVLVAVGDKIEVDSGLITLETDKATMDVPSPFAGVVKDVKVAV
GDKVSQGSLVIMLEVGGAAPAAAPTVAAQAAPAAMVAPVAAAPAAPAASVVAVKEIQVPD
IGDASNVDVIEVLVSVGDEITADQGLITLETDKATMEVPAPFAGKLLSLTVKVGDKVSQG
SVIATIETVTAGAAPAPVAQAAAPAPVSAAPVAAPTPASRPPVPHHPSAGTPVSTGAVHA
SPAVRRLAREFGVDLTQVAGTGRKGRIMKEDVQAYVKYELSRPKATAATSVGSGNGGGLQ
VIAAPKVDFSKFGEVEEIPLSRIQKISGPNLHRNWVTIPHVTQFDEADITEMEEFRKQQN
DVAAKKKADYKITPLVFMLKAVAKTLQQFPVFNSSLSSDGESLIQKKYFHIGVAVDTPNG
LVVPVVRDVDKKGIIELSRELADISIRARDGKLKSADMQGSCFTISSLGGIGGTAFTPIV
NYPDVAILGVSKSEIKPKWNGKEFEPKLMLPLSLSYDHRVIDGAMAARFSVTLSGILSDI
RTLVL
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattaaaagaagtttttgttcctgatatcggcggcgatgaagtgcaagtgatc
gaaatttgtgtggctgtgggtgataccctagcggcagaagaatcgattcttaccgtcgaa
agcgacaaggcgactatggatattccagcgcctttcgccggtgttttagccgaattgaaa
gtggctgtgggcgataaagtatctgaaggtactttgattgctatgatgcaagcagcgggc
gcggcagctgccgctccggctccagttgcagcacccgctcaggcggcaccagcatctgca
ccagttcaagcggctcctgcccctgtggctgctgctcctgcgacgggcgcaaccaaagtg
gttgaagtgactgtgcctgatatcggtggcgacactgatgtgtcggttatcgaagtcctg
gttgctgtcggtgacaagattgaagttgatagcggtttaattaccctagaaacagacaaa
gcgaccatggacgtgccatcacctttcgcgggtgtggttaaagacgttaaagtcgcagtt
ggcgataaagtgtcgcaaggctctttagtcatcatgcttgaagttggcggcgctgcacct
gcagccgcgccaactgttgctgcccaagcggctcctgccgctatggtagcgccagtggcc
gcagcacctgctgcaccagcggcaagtgtggttgcggtaaaagaaattcaagtgcctgat
attggcgatgccagcaatgtcgatgtgatcgaagtgctcgtgtctgtcggtgatgaaatc
actgctgaccaaggtttgattacccttgaaactgacaaagccaccatggaagtgcctgcg
ccattcgccggtaaactgctgtctttgactgttaaagtgggtgacaaggtttctcagggt
agcgtcattgcgacgattgagactgtcactgcaggtgcagctcctgcacctgttgctcaa
gctgcggctcctgctccagtgagtgcggcgcccgttgcagccccaacaccagcaagccgt
cctccagtaccacaccacccaagcgcaggtacacctgtgtctaccggtgcggtacatgcg
tctcctgcggtacgtcgtttagcccgagaatttggtgtcgacttgacccaagttgctggt
actggccgtaaaggtcgcattatgaaagaagacgttcaggcgtatgtgaaatacgaactg
tctcgtccgaaagcgactgcggcaacctcagtcggttcaggtaacggcggcggtctgcaa
gtgattgcagcacctaaagttgatttcagtaagtttggtgaagtggaagagattccatta
agccgtatccagaagatttctggccctaacttacaccgcaactgggtaactattccgcac
gtgactcagttcgatgaagctgatatcactgaaatggaagagttccgtaagcagcaaaac
gatgtagcggcgaagaagaaagccgattacaagatcacgcctttagtgtttatgctaaaa
gctgtggctaaaacgttgcaacagttcccagtgttcaactcaagcttaagtagcgatggc
gaatcactgatccagaagaagtacttccacatcggtgtggcggttgatacgccaaacggt
ttggttgtgccagtcgtgcgtgacgtggataagaaaggcattatcgagttatctcgtgaa
ctggctgacatctctatccgtgcccgtgatggcaagctgaaatctgctgatatgcaaggt
agctgttttactatttcaagtttaggtggcattggcggtacagcgtttacgcctatcgtt
aactacccagacgtggcgattttaggtgtgtctaaatctgaaattaagcctaagtggaat
ggtaaagagttcgaacctaaattgatgttgcccttgtcgctgtcatacgatcaccgtgtg
atcgatggtgctatggctgcacgctttagtgtgacgctgtcaggaattctgtccgatatt
cgtactttggttctgtaa

DBGET integrated database retrieval system