KEGG   Salmonella bongori NCTC 12419: SBG_1611Help
Entry
SBG_1611          CDS       T01579                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SBG_1611 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBG_1611 (adh)
   00620 Pyruvate metabolism
    SBG_1611 (adh)
   00650 Butanoate metabolism
    SBG_1611 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    SBG_1611 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SBG_1611 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SBG_1611 (adh)
   00626 Naphthalene degradation
    SBG_1611 (adh)
Enzymes [BR:sbg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SBG_1611 (adh)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SBG_1611 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1758062..1760740
Genome map
AA seq 892 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKEATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFASHGGYMLQGQELKAVQDVILKNGALNAAIVGQP
AYKIAELAGFSVPETTKILIGEVTIVDESEPFAHEKLSPTLAMYRAKDFEEAVEKAEKLV
AMGGIGHTSCLYTDQDNQQDRVNYFGQKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLSVVRKGAELANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKENLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEVAD
HLGLSQPGDRTAAKIERLLGWLESLKAELGIPKSIREAGVQEADFLANVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGRDFTEGETAAKKVIVAAPKAEKKAKKSA
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaacttaacgcactcgtagagcgtgtaaaaaaagcccag
cgtgaatatgccagtttcactcaagaacaagtcgacaaaatcttccgcgctgccgctctg
gccgctgctgatgcccgaattccgctggctaaaatggccgttgctgaatccggtatgggt
atcgttgaagataaagtgattaaaaaccacttcgcttccgaatatatctacaacgcctat
aaagatgaaaaaacctgcggcgtgctgtctgaagatgacaccttcgggactatcactatt
gcagaacctatcggcattatttgcggtatcgtgccaactactaacccgacgtctactgct
atcttcaaatctctgattagcctgaagacccgtaacgccatcatcttctccccacatccg
cgcgctaaagaagcaaccaacaaagccgcagatatcgttctgcaggcggctatcgccgca
ggcgcgccgaaagatctcatcggctggatcgatcaaccttccgtcgagctgtctaacgct
ctgatgcaccacccggatatcaacctgattctggcaacaggtggccctggcatggttaaa
gcagcgtacagttccggtaaaccagctatcggcgtgggcgcgggcaacacccccgttgtc
attgatgaaaccgctgatatcaaacgtgctgtcgcgtctgttttgatgtccaaaaccttc
gataacggcgttatctgtgcttctgaacagtctgttgttgttgttgattccgtttatgat
gccgttcgcgaacgtttcgccagccacggcggctacatgctgcaagggcaggagctgaaa
gcggttcaggacgtcattctgaaaaatggcgcgctgaacgccgctattgttggtcagcca
gcatacaaaatcgctgaactggcaggtttctccgtaccagagaccaccaagatcctgatt
ggtgaagtcacgattgttgatgaaagcgagccgtttgcccacgaaaaactgtctccgaca
ctggcgatgtatcgcgcgaaagatttcgaagaagcggttgagaaagcagaaaaactggtg
gcgatgggcggtattgggcacacctcttgcctgtacactgaccaggacaaccagcaggat
cgcgtgaactacttcggccagaagatgaaaaccgcgcgtatcctgattaacaccccggcg
tctcagggtggtatcggtgacctgtacaacttcaaactcgcaccttccctgactctgggt
tgtggttcctggggtggtaactccatctccgaaaacgttggtccgaaacatctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcataaacttccgaaatctatc
tacttccgccgtggatctctgcctatcgcgctggatgaagtgattaccgatggacacaaa
cgtgcgctcatcgtcactgaccgtttcctgtttaacaatggttatgccgatcagatcacc
tctgtactgaaagcggctggcgttgaaactgaagtcttctttgaagttgaagctgaccca
accctgtctgttgttcgcaaaggcgctgaactggcgaattcctttaaaccagacgtgatt
attgcgctgggcggcggttccccgatggatgctgcaaaaatcatgtgggtaatgtacgaa
catccggaaacccacttcgaagaactggcgctgcgctttatggatatccgtaaacgtatc
tacaagttcccgaaaatgggcgtgaaagcgaaaatgatcgccgtcaccaccacttccggt
actggttctgaagtaacgccattcgcggttgtgacggatgatgctactggccagaaatat
ccgctggcagactatgcgctgaccccagatatggcgattgtcgacgccaacctggtaatg
gatatgccgaagtctctgtgcgcattcggtggtcttgatgcggtcactcacgcgctggaa
gcttatgtttctgtactggcttcagaattctctgacggtcaggcgctgcaggcactgaaa
ctgctgaaagaaaatctgccggcatcttatcacgaagggtctaaaaacccggtagcccgt
gagcgtgttcacagtgcagcgactatcgccggtatcgcgtttgctaacgccttcctcggc
gtatgtcactctatggcgcacaaactgggttctcagttccatattccgcatggcctggcg
aatgccctgctgatttgcaacgttatccgctataacgcgaatgacaacccaaccaagcaa
accgccttcagccagtacgaccgtccgcaggcacgccgtcgttatgcggaagttgctgac
catctgggtctgagccaaccgggcgaccgcaccgcggcgaaaatcgaaaggctgctgggc
tggctggaaagcctgaaagcggaactgggtattccgaaatctatccgcgaagccggcgtt
caggaagctgacttcctggcgaatgtcgacaaactgtctgaagatgctttcgatgaccag
tgtaccggcgcgaacccgcgttacccgctgatctccgaactgaaacagattctactggat
acttactacggtcgtgatttcaccgaaggtgaaactgcagcgaagaaagttatcgttgcc
gccccgaaagcagagaaaaaagcgaaaaaatccgcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system