KEGG   Streptomyces bingchenggensis: SBI_03962Help
Entry
SBI_03962         CDS       T01678                                 

Definition
putative sugar hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sbh  Streptomyces bingchenggensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sbh00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sbh00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5058807..5060381)
Genome map
AA seq 524 aa AA seqDB search
MTTLARGLDTLTRDALAVLQPGFTGTTAPDWVLRRLGEGLGSVGIFGRNITSSEQLAALT
AQLRAEREDLLVAIDEEGGDVTRLEVRTGSSFPGNLALGAVDDTALTQAVAREMGRRLAA
CGVNLDWAPSADVNSNPDNPVIGVRAFGADPQLVARHTAAYIRGLQGAGVAACTKHFPGH
GDTAVDSHHAMPRIDADLDTLTARELIPFRAAVAAGTKAVMSAHILVPALDSALPATLSP
AALHGLLRAPVSEGGLGFEGLIVTDGMEMRAISAAYGIERGSVLAIAAGADAICVGGGLS
DEDTVVRLRDALVAAVRAGELPEARLADAAARVRALGDWARQTGGPGAAEGIAPAPEAGL
RAARRALRVTPGDQPYEPPTGPAFVAAFTPMANIAVGDETPWGVAAELARLLPGTGTATY
GQRDAEGAEGAADGATGGVPALIANVLGKAADRRIVAVVRDVHRHPWMADALDTLLAARP
DTVVVEMGVPQAPPTGALHIATHGAARVCGLAAAEVITGGVAGG
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccctcgcacgcggcttggacactctcaccagggacgccctggcggttctgcaa
cccggattcaccggcaccaccgcgcccgactgggtgctgcggcggctcggtgaaggactc
ggctccgtcggcatcttcggccgcaacatcacctcgtccgagcagctcgccgccctcacc
gcccagctgcgggccgaacgcgaagacctgctcgtcgccatcgacgaagagggcggcgac
gtcacccgtcttgaggtgcggaccggctcctccttccccggcaacctggcgctgggcgcg
gtcgacgacaccgccctgacccaggccgtggcccgcgagatgggccgccggctcgccgca
tgcggggtcaacctcgactgggcgccgtccgccgacgtcaactccaaccccgacaacccg
gtcatcggcgtacgggccttcggcgccgacccgcagctcgtggcccgccacaccgccgcg
tacatccggggcctccagggcgccggggtcgccgcctgcaccaagcacttccccgggcac
ggcgacaccgccgtcgactcccaccacgccatgccgcgtatcgacgccgacctcgacacc
ctcaccgcccgcgaactgatccccttccgggccgccgtggccgccggcaccaaggccgtg
atgagcgcccacatcctggtgcccgccctcgactccgccctgcccgccaccctcagcccg
gccgcgctgcacggtctgctgcgcgcccccgtcagcgagggcggcctcggcttcgaaggg
ctcatcgtcaccgacggcatggagatgcgggccatctccgccgcgtacggcatcgaacgc
ggcagcgtgctcgccatcgccgcgggcgccgacgcgatctgcgtcggcggcggactcagc
gacgaggacaccgtggtgcggctgcgcgacgcgctggtggccgcggtacgggccggggaa
ctgcccgaggcccggctcgccgacgccgcggcccgggtgcgcgccctcggcgactgggcg
cgacagaccggagggccgggcgcggcagaggggatcgcgcccgcccctgaggccgggctg
cgcgccgcccgccgggcgctgcgcgtcaccccgggcgaccagccgtacgagccgcccacc
gggcccgcgttcgtcgccgccttcacccccatggccaatatcgccgtcggcgacgagacc
ccctggggcgtcgccgccgaactggcccggctgctgcccggcaccggcaccgccacctac
ggccagcgagacgcagagggcgcagagggggctgcggacggcgcgaccggcggtgtgccc
gccttgatcgcaaatgtactcgggaaggcggctgaccgtaggatcgtcgcagtggtacgc
gatgtccaccgccacccctggatggccgacgccctggacaccctgctcgccgcccggccg
gacacggtcgtcgtcgagatgggcgtgccccaggcgccgccgaccggggcgctgcacatc
gcgactcacggcgccgcccgggtctgtgggctggccgccgcggaggtcatcaccggcggc
gtggccgggggatga

DBGET integrated database retrieval system