KEGG   Streptomyces bingchenggensis: SBI_06013Help
Entry
SBI_06013         CDS       T01678                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sbh00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7308195..7309229
Genome map
AA seq 344 aa AA seqDB search
MSTHGSSTHGSTPYGSFPGARPRRLRVNAAMRRMVAETRLHPAELILPAFVTEGATEPMP
LAAMPGVVQHTRDSLRKAAVEAVEAGVGGIMIYGVPETAKKDAIGSPGTDPDGILQVALR
DVRSEVGDELVVMSDLCLDEHTDHGHCGVLDAEGRVDNDATLERYAEMARVQADAGAHVL
GASGMMDGQVGVARAALDGIGRQDVSILAYAVKYASAFYGPFREAVASSLKGDRKTYQQD
GANAREALRELALDLAEGADMVMVKPALPYLDILRRIADEADVPVAAYQISGEYAMVEAA
AANGWIDRNQAIMETLTSVRRAGAGMVLTYWATEVAQWLNRGDV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
ttgagcacccacggcagcagcacgcacggctccaccccgtacgggagcttccccggcgcc
cggccgcgccgactgcgggtgaacgcggccatgcggcgcatggtcgccgagacccggctg
cacccggccgagctgatcctgcccgccttcgtcacggagggcgcgactgagccgatgccg
ctggccgcgatgccgggcgtcgtccagcacacccgcgactcgctgcggaaggcggctgtc
gaggcggtcgaggccggcgtcggcgggatcatgatctacggcgtgccggagacggccaag
aaggacgcgatcggctcgccgggcaccgacccggacggcatcctccaggtcgccctccgc
gatgtgcggtccgaggtcggcgacgaactggtcgtcatgtccgacctgtgcctggacgag
cacaccgaccacggccactgcggcgtgctcgacgccgagggccgggtcgacaacgacgcg
acgctggagcgctacgccgagatggcgcgggtgcaggcggacgcgggcgcccatgtgctc
ggcgcgagcggaatgatggacggccaggtcggggtcgcccgggcggccctggacggcatc
ggccgccaggacgtgtcgatcctcgcctacgccgtcaagtacgcctcggccttctacgga
cccttccgcgaggccgtggcgtcctcgctcaagggcgaccgcaagacctaccagcaggac
ggggccaacgcccgggaggcgctgcgcgaactggcgctggacctggccgagggcgccgac
atggtgatggtcaagcccgcgctgccgtacctggacatcctgcgccggatcgcggacgag
gcggacgtgccggtcgccgcgtaccagatctccggcgagtacgcgatggtcgaggccgcc
gcggccaatggatggatcgaccggaaccaggcgatcatggagacgctgacgtccgtacgg
cgggcgggggcgggcatggtcctgacctactgggcgaccgaggtcgcgcagtggctgaac
cggggcgacgtctga

DBGET integrated database retrieval system