KEGG   Streptomyces bingchenggensis: SBI_06486Help
Entry
SBI_06486         CDS       T01678                                 

Gene name
gtaB
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SBI_06486 (gtaB)
   00052 Galactose metabolism
    SBI_06486 (gtaB)
   00500 Starch and sucrose metabolism
    SBI_06486 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    SBI_06486 (gtaB)
Enzymes [BR:sbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SBI_06486 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7823721..7824623
Genome map
AA seq 300 aa AA seqDB search
MTQARTRISKAVIPAAGLGTRFLPATKATPKEMLPVVDKPAIQYVVEEAVTAGLPDVLMV
TGRNKRPLEDHFDRNYELEEALSRKGDETRLARVQESSDLATMHYVRQGDPRGLGHAVLC
AAPHVGDQPFAVLLGDDLIDARDPLLSHMVEVQEQHGGSVIALMEVDPAQIHLYGCAAVK
PTLDGDVVRVTGLVEKPDPADAPSNYAVIGRYVLDPAVFDVLRATEPGRGGEIQLTDALQ
ALAANPDLGGPVHGVVFKGRRYDTGDRGDYLRAIVRLACEREDLGPDFRDWLRRYVTEEM
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagcgcgtactcggatcagcaaggctgtcatccccgccgcggggctcggaacc
cgcttcctgccggccacgaaggccacccccaaggagatgctgccggtcgtcgacaagccg
gcgatccagtacgtcgtcgaggaagccgtcaccgccgggctgcccgatgtgctcatggtc
acgggccgtaacaagcggcccctggaggaccacttcgatcgcaactacgagctcgaagag
gccctgagccgcaagggcgacgagacccgactcgcccgtgtgcaggagtccagcgatctc
gcgaccatgcactacgtccgccagggcgaccccaggggcctcggccacgccgtgctctgc
gccgccccgcacgtcggtgaccagccctttgccgtcctcctcggcgacgacctcatcgat
gcccgcgatccgctcctgtcccacatggtcgaggtgcaggagcagcatggcggcagcgtc
atcgccctgatggaggtggaccccgcccagatccacctctacggctgcgcagcggtcaag
ccgaccctggacggcgacgtggtgcgggtgaccgggctcgtcgagaagccggacccggcc
gacgcgcccagcaactacgccgtcatcggccgctatgttctcgaccccgccgtcttcgac
gtgctgcgcgccaccgagcccgggcgcggcggcgagatccagctcaccgacgccctgcag
gcgctcgccgccaatccggacctcggcgggccggtccacggggtcgtcttcaaggggcgc
cgctacgacacaggcgaccgtggcgactatctgcgtgccattgtcagactcgcgtgcgaa
cgtgaagacctgggcccggacttccgggactggcttcgccgttacgtcaccgaggagatg
tag

DBGET integrated database retrieval system