KEGG   Streptomyces scabiei: SCAB_67051Help
Entry
SCAB_67051        CDS       T01187                                 

Definition
dihydrolipoyllysine-residue succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
scb  Streptomyces scabiei
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCAB_67051
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCAB_67051
  Amino acid metabolism
   00310 Lysine degradation
    SCAB_67051
Enzymes [BR:scb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SCAB_67051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7420759..7422564)
Genome map
AA seq 601 aa AA seqDB search
MAVSVTLPALGESVTEGTVTRWLKAEGERVEADEPLLEVSTDKVDTEIPSPAAGILASIK
VAEDETVEVGAELALIDDGSGAPAAAPAPAAEEAPAPAPEPAAAAPSTEQEAPAPAPTAE
AATGAGSAEGTDVVLPALGESVTEGTVTRWLKEVGDSVEADEPLLEVSTDKVDTEIPAPT
SGVLLEITVAEDETAEVGAKLAVIGAPGAAPAAAPAAPAPAPAAAAPAAAAPAPAAPAAP
APAPAPAAPAAPAPAPAAAAPAAPAAAPAPVTPAPAAVPAAAKATDEGAYVTPLVRKLAA
EHGVDLGSVKGTGVGGRIRKQDVVAAAEAAKAAAAAPAPAAAVTAGGHAAAPKKAPTLEA
SPLRGQTIKMPRIRKVIGDNMVKALHEQAQLSSVVEVDVTRLMRLRARAKDSFAAREGVK
LSPMPFFVKAAAQALKAHAPINARINEADGTITYFDAENIGIAVDSEKGLMTPVIKGAGD
LNIAGIAKATADLAGKVRANKITPDELSGATFTISNTGSRGALFDTIIVPPNQVAILGIG
ATVKRPAVIETEEGTVIGVRDMTYLTLSYDHRLVDGADAARYLTAVKAILEAGEFEVELG
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttccgtaacccttccggcgctcggcgagagcgtcaccgagggcactgtcacc
cgctggctgaaggccgagggtgagcgcgtagaggccgacgagccgctgctcgaggtctcg
accgacaaggtcgacaccgagatcccctcccccgccgcgggcatcctggcctccatcaag
gtcgccgaggacgagacggtcgaggtcggcgccgagctggccctgatcgacgacggctcg
ggcgcgcccgccgccgccccggcccccgccgccgaggaggcccccgcgccggcccccgag
cccgccgcggccgcgccctccaccgagcaggaggcccccgccccggccccgaccgccgag
gcggccaccggcgccggctcggccgagggcaccgacgtggtcctcccggcgctcggcgag
tccgtcaccgagggcaccgtcacccgctggctgaaggaggtcggcgactcggtcgaggcc
gacgagccgctcctcgaggtctccaccgacaaggtcgacaccgagatcccggcgcccacc
tccggtgtgctcctggagatcacggtcgccgaggacgagaccgccgaggtcggcgccaag
ctggccgtcatcggcgccccgggtgccgctccggcggctgccccggccgccccggccccg
gcgcccgccgccgctgccccggccgccgccgcgcccgccccggccgcccccgcggctccg
gccccggctcccgcgcctgccgcccccgccgctccggctccggcgcccgccgccgctgcc
ccggccgctccggccgccgcgcccgctccggtcaccccggctccggccgccgtcccggct
gccgccaaggccaccgacgagggcgcctacgtcacccccctggtgcgcaagctcgccgcc
gagcacggtgtcgacctgggctccgtcaagggcaccggcgtcggcggccgtatccgcaag
caggacgtcgtcgccgccgccgaggccgcgaaggccgctgccgccgctccggctccggcc
gccgctgtgactgccgggggccatgccgccgcccccaagaaggcgccgaccctggaggct
tctcccctccgcggccagaccatcaagatgccgcgcatccgcaaggtcatcggcgacaac
atggtcaaggcgctgcacgagcaggcgcagctgtcgtcggtcgtcgaggtcgacgtcacc
cgtctgatgcggctgcgcgcccgcgccaaggactcgttcgcggcgcgcgagggcgtgaag
ctctccccgatgccgttcttcgtgaaggccgcggcccaggcgctgaaggcgcacgcgccc
atcaacgcccggatcaacgaggccgacggcacgatcacctacttcgacgccgagaacatc
ggtatcgcggtggactccgagaagggcctgatgaccccggtcatcaagggcgccggtgac
ctcaacatcgccggtatcgccaaggccaccgccgacctggcgggcaaggtgcgtgccaac
aagatcacgccggacgagctgtccggtgcgaccttcaccatctccaacaccggttcgcgc
ggcgcgctgttcgacacgatcatcgtgccgccgaaccaggtcgcgatcctcggcatcggc
gccacggtcaagcgccccgccgtgatcgagacggaggagggcacggtcatcggcgtccgc
gacatgacgtacctgaccctctcctacgaccaccgtctggtcgacggcgccgacgcggcc
cgttacctgacggcggtcaaggcgatcctggaggcgggcgagttcgaggtcgagctcggt
ctgtag

DBGET integrated database retrieval system