KEGG   Streptomyces scabiei: SCAB_77971Help
Entry
SCAB_77971        CDS       T01187                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
scb  Streptomyces scabiei
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SCAB_77971
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SCAB_77971
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SCAB_77971
Enzymes [BR:scb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SCAB_77971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8615621..8617246)
Genome map
AA seq 541 aa AA seqDB search
MAGSVTGGAFMSHRPPSPLPGRRNVLRGSLAASAALALPGSVALGSVPALALSGRPRAGW
GVQAGDVTAHSGLVWVRSDRPARMIVETAATESFRNPRRWHGPLLDAGTDFTGTTRLRGL
PSGEQIHYRVLLADPDDPRRTGEPVTGTFRTTSPKRSSGARFVWSGDLAGQGWGINPDRG
GYRIFDAMGALDPDFFLCSGDNIYADGPVAATVALPDGSTWRNVTTEEKSKVAETLAEFR
GNFRYNLLDENLKRFNARVPSIVQWDDHEVTNNWYPGEILTDARYTEKSVDVLAARARRA
FSEYFPISTLRPGAREGRVHRVLRHGPLLDVFVLDMRTYRNANSPDTQTTDAVGILGAEQ
LEWLKRELSRSRAVWKVIASDMPLGLVVPDTGDGKPNIEAVAQGDPGAPLGRELQIAELL
RFIKHRKVTGTVWLTADVHYTSAQHYQPSRAAFTDFEPFWEFVSGPLNAGAFPSNALDNT
FGPERVFMKAPTTANVSPAGGYQFFGEVDIDGHSGELTVRLREQDGTVLYTKVLQPGLVG
Q
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
ttggccggatccgtcactggaggcgctttcatgtcacaccgtccaccgagtcccctgccc
ggtcgccgcaacgtgctgcgcggctcgctcgccgcgtcggccgcgctggcgctgcccgga
tccgtcgcgctcggttcggtgccggcgctggccctctcggggcggccgcgggccggctgg
ggtgtgcaggccggagacgtgaccgcgcactccggtctggtgtgggtgcggtcggaccgt
ccggcccggatgatcgtcgagacggcggccaccgagtcgttccgcaacccgcgcagatgg
cacggcccgctgctggacgccggtacggacttcaccggtacgacgcgcctgcgcggcctg
ccctcgggtgagcagatccactaccgggtgctgctggccgacccggacgacccgcgccgc
accggtgagccggtcaccggcaccttccgtacgacgtcgccgaagcggagttccggggcg
cggttcgtgtggtcgggcgacctggcggggcagggctggggcatcaaccccgaccgcggc
ggctaccgcatcttcgacgcgatgggcgccctcgacccggacttcttcctgtgcagcggc
gacaacatctacgccgacggtccggtcgcggcgacggtcgcgctgccggacgggagcacc
tggcggaacgtcaccaccgaggagaagtccaaggtcgcggagacgctcgcggagttccgg
ggcaacttccgctacaacctgctggacgagaacctgaagaggttcaacgcacgggtcccg
tcgatcgtgcagtgggacgaccacgaggtcaccaacaactggtacccgggcgagatcctc
accgacgcccggtacaccgagaagagcgtggacgtgctggcggcacgggcgcggcgggcc
ttcagcgagtacttccccatctccacgctgcggccgggcgcccgggagggccgcgtgcac
cgcgtgctgcgccacggccctctgctggacgtgttcgtgctggacatgcggacctaccgc
aacgccaactcgcccgacacgcagaccaccgacgcggtcggcatcctcggcgccgagcag
ctggagtggctcaagcgggagctgtcgaggtcgcgggcggtgtggaaggtgatcgcctcc
gacatgccgctcggtctggtcgtgcccgacaccggggacggcaagccgaacatcgaggcc
gtggcccagggcgacccgggcgctccgctggggcgggagctccagatcgccgagctgctg
cggttcatcaagcaccgcaaggtcaccggcacggtgtggctgacggcggacgtgcactac
acctcggcgcagcactaccagccgtcgcgggccgcgttcaccgacttcgagccgttctgg
gagttcgtctcgggcccgctcaacgccggcgccttcccgtcgaacgcgctcgacaacacc
ttcggccccgaacgggtgttcatgaaggcgccgacgacggcgaacgtctcgccggcgggc
ggctaccagttcttcggcgaggtcgacatcgacggccacagcggtgagctgacggtccgg
ctgcgggaacaggacgggacggtgctgtacacgaaggtgctccagccggggctcgtgggg
cagtga

DBGET integrated database retrieval system