KEGG   Saccharomyces cerevisiae (budding yeast): YDL101CHelp
Entry
YDL101C           CDS       T00005                                 

Gene name
DUN1
Definition
Dun1p (EC:2.7.11.1)
Orthology
K06641  
serine/threonine-protein kinase Chk2 [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
IV:complement(280307..281848)
Genome map
AA seq 513 aa AA seqDB search
MSLSTKREHSGDVTDSSFKRQQRSNKPSSEYTCLGHLVNLIPGKEQKVEITNRNVTTIGR
SRSCDVILSEPDISTFHAEFHLLQMDVDNFQRNLINVIDKSRNGTFINGNRLVKKDYILK
NGDRIVFGKSCSFLFKYASSSSTDIENDDEKVSSESRSYKNDDEVFKKPQISATSSQNAT
TSAAIRKLNKTRPVSFFDKYLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQK
KNKQFREETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCL
RQDESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQ
VKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPP
FSDQLGPPSLKEQILQAKYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEALNHPWF
NDIQQQSSVSLELQRLQITDNKIPKTYSELSCL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgtccacgaaaagagagcactctggtgatgtaactgactcttcattcaaaaga
cagcaacgaagtaataagcccagctcagaatacacttgtctgggccatctggtgaactta
atacccggaaaggagcaaaaagtggaaataacaaatagaaacgttactacaatcggtaga
agtaggtcgtgcgacgttatattgagtgagcctgacatctcgactttccatgctgagttt
catctactgcaaatggatgtggataatttccaaagaaatttgattaatgttatcgataag
agcagaaacggaacttttattaatggtaatcgtttggtgaagaaagactacatccttaag
aatggtgacagaattgtctttggcaaaagttgctcctttttgttcaagtacgcatcttca
tcttctactgacatcgaaaatgacgatgaaaaggtaagttcagaaagtcgttcatataag
aacgacgacgaagttttcaagaaaccgcaaataagtgctacaagtagccaaaatgctaca
acgagtgccgcaattagaaaactgaataagacaaggcctgtgtcgttctttgataaatat
ttattaggtaaagaattaggtgcagggcactacgccctggtgaaagaagccaaaaacaaa
aaaactggtcagcaagtagctgtgaaaatattccacgctcagcaaaatgacgaccaaaaa
aagaataaacaatttagggaggaaactaacatcctaatgagagtgcaacatccaaacatt
gtcaacttactagatagttttgtagagccaatcagcaaatctcagattcaaaaatatttg
gtactggaaaagatcgacgatggcgaactatttgaaagaatcgtcagaaaaacatgtttg
agacaggatgaatccaaagctctattcaaacagttacttaccggattgaagtatctgcat
gagcaaaacatcattcacagagacatcaagccagaaaatatcttattaaatataacaagg
cgcgaaaatccaagtcaagtccaacttggcccatgggatgaagatgaaattgatattcaa
gttaaaatagcggattttggcctagcaaaatttacaggagaaatgcaattcacaaacaca
ctttgtggtacgccttcttatgtagcgcccgaagtcctcacaaagaaaggatacacatca
aaagtagatctttggagtgctggtgtcatattatatgtctgtttatgtggttttcctcca
ttcagtgatcaattggggccaccttcattgaaggaacagatcttacaagctaagtatgcg
ttttactctccgtactgggataaaatcgatgactcagtactacatttaatatccaatctt
ttggtcctaaatcctgatgaaaggtacaatatagatgaagctttgaaccacccttggttc
aatgacatacagcaacaaagctcggtctcattagaattgcagcgtttacaaattactgac
aataaaatacccaaaacatactcagaattatcttgcctctaa

DBGET integrated database retrieval system