KEGG   Saccharomyces cerevisiae (budding yeast): YDR050CHelp
Entry
YDR050C           CDS       T00005                                 

Gene name
TPI1
Definition
triose-phosphate isomerase TPI1 (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YDR050C (TPI1)
   01230 Biosynthesis of amino acids
    YDR050C (TPI1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YDR050C (TPI1)
   00051 Fructose and mannose metabolism
    YDR050C (TPI1)
   00562 Inositol phosphate metabolism
    YDR050C (TPI1)
Enzymes [BR:sce01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     YDR050C (TPI1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   YDR050C (TPI1)
  Exosomal proteins of bladder cancer cells
   YDR050C (TPI1)
  Exosomal proteins of melanoma cells
   YDR050C (TPI1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
IV:complement(555726..556472)
Genome map
AA seq 248 aa AA seqDB search
MARTFFVGGNFKLNGSKQSIKEIVERLNTASIPENVEVVICPPATYLDYSVSLVKKPQVT
VGAQNAYLKASGAFTGENSVDQIKDVGAKWVILGHSERRSYFHEDDKFIADKTKFALGQG
VGVILCIGETLEEKKAGKTLDVVERQLNAVLEEVKDWTNVVVAYEPVWAIGTGLAATPED
AQDIHASIRKFLASKLGDKAASELRILYGGSANGSNAVTFKDKADVDGFLVGGASLKPEF
VDIINSRN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctagaactttctttgtcggtggtaactttaaattaaacggttccaaacaatccatt
aaggaaattgttgaaagattgaacactgcttctatcccagaaaatgtcgaagttgttatc
tgtcctccagctacctacttagactactctgtctctttggttaagaagccacaagtcact
gtcggtgctcaaaacgcctacttgaaggcttctggtgctttcaccggtgaaaactccgtt
gaccaaatcaaggatgttggtgctaagtgggttattttgggtcactccgaaagaagatct
tacttccacgaagatgacaagttcattgctgacaagaccaagttcgctttaggtcaaggt
gtcggtgtcatcttgtgtatcggtgaaactttggaagaaaagaaggccggtaagactttg
gatgttgttgaaagacaattgaacgctgtcttggaagaagttaaggactggactaacgtc
gttgtcgcttacgaaccagtctgggccattggtaccggtttggctgctactccagaagat
gctcaagatattcacgcttccatcagaaagttcttggcttccaagttgggtgacaaggct
gccagcgaattgagaatcttatacggtggttccgctaacggtagcaacgccgttaccttc
aaggacaaggctgatgtcgatggtttcttggtcggtggtgcttctttgaagccagaattt
gttgatatcatcaactctagaaactaa

DBGET integrated database retrieval system