KEGG   Saccharomyces cerevisiae (budding yeast): YGL062WHelp
Entry
YGL062W           CDS       T00005                                 

Gene name
PYC1
Definition
pyruvate carboxylase 1 (EC:6.4.1.1)
Orthology
K01958  
pyruvate carboxylase [EC:6.4.1.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YGL062W (PYC1)
   01230 Biosynthesis of amino acids
    YGL062W (PYC1)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YGL062W (PYC1)
   00620 Pyruvate metabolism
    YGL062W (PYC1)
Enzymes [BR:sce01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     YGL062W (PYC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VII:385196..388732
Genome map
AA seq 1178 aa AA seqDB search
MSQRKFAGLRDNFNLLGEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQ
KADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGI
TWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAA
FGGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGN
VVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN
QNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLPQLGLFQDKITTRGFAIQC
RITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTY
EIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNR
AQKLLHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLL
EKGPAEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALEC
WGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA
KDNGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCFSGDMLQPGKKYNLDYYLEIA
EKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTACA
LAGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCF
EADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPT
SKVVGDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRN
KRRKLTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNMYPRVYEDFQKMRETYGDL
SVLPTRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIRV
ADRSQKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMII
SSPSDGQVKEVFVSDGENVDSSDLLVLLEDQVPVETKA
NT seq 3537 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaagaaaattcgccggcttgagagataacttcaatctcttgggtgaaaagaac
aaaatattggtggctaatagaggagaaattccaatcagaatttttcgtaccgctcatgaa
ctgtctatgcagacggtagctatatattctcatgaagatcgtctttcaacgcacaaacaa
aaggctgacgaagcatacgtcataggtgaagtaggccaatatacccccgtcggcgcttat
ttggccattgacgaaatcatttccattgcccaaaaacaccaggtagatttcatccatcca
ggttatgggttcttgtctgaaaattcggaatttgccgacaaagtagtgaaggccggtatc
acttggattggccctccagctgaagttattgactccgtgggtgataaggtctcagctaga
aacctggcagcaaaagctaatgtgcccaccgttcctggtacaccaggtcctatagaaact
gtagaggaagcacttgacttcgtcaatgaatacggctacccggtgatcattaaggccgcc
tttggtggtggtggtagaggtatgagagtcgttagagaaggtgacgacgtggcagatgcc
tttcaacgtgctacctccgaagcccgtactgccttcggtaatggtacctgctttgtggaa
agattcttggacaagccaaagcatattgaagttcaattgttggccgataaccacggaaac
gtggttcatcttttcgaaagagactgttccgtgcagagaagacaccaaaaggttgtcgaa
gtggccccagcaaagactttaccccgtgaagtccgtgacgccattttgacagatgcagtt
aaattggccaaagagtgtggctacagaaatgcgggtactgctgaattcttggttgataac
caaaatagacactatttcattgaaattaatccaagaatccaagtggaacataccatcaca
gaagaaattaccggtatagatattgtggcggctcagatccaaattgcggcaggtgcctct
ctaccccagctgggcctattccaggacaaaattacgactcgtggctttgccattcagtgc
cgtattaccacggaagaccctgctaagaacttccaaccagataccggtagaatagaagtg
taccgttctgcaggtggtaatggtgttagactggatggtggtaacgcctatgcaggaaca
ataatctcacctcattacgactcaatgctggtcaaatgctcatgctccggttccacctac
gaaatcgttcgtagaaaaatgattcgtgcattaatcgagttcagaattagaggtgtcaag
accaacattcccttcctattgactcttttgaccaatccagtatttattgagggtacatac
tggacgacttttattgacgacaccccacaactgttccaaatggtttcatcacaaaacaga
gcccaaaaacttttacattacctcgccgacgtggcagtcaatggttcatctatcaagggt
caaattggcttgccaaaattaaaatcaaatccaagtgtcccccatttgcacgatgctcag
ggcaatgtcatcaacgttacaaagtctgcaccaccatccggatggaggcaagtgctacta
gaaaaggggccagctgaatttgccagacaagttagacagttcaatggtactttattgatg
gacaccacctggagagacgctcatcaatctctacttgcaacaagagtcagaacccacgat
ttggctacaatcgctccaacaaccgcacatgcccttgcaggtcgtttcgccttagaatgt
tggggtggtgccacattcgatgttgcaatgagatttttgcatgaggatccatgggaacgt
ttgagaaaattaagatctctggtgcctaatattccattccaaatgttattgcgtggtgcc
aatggtgtggcttattcttcattgcctgacaatgctattgaccatttcgtcaagcaagcc
aaggataatggtgttgatatatttagagtctttgatgccttaaatgacttggaacaattg
aaggtcggtgtagatgctgtgaagaaggcaggtggtgttgtagaagccactgtttgtttc
tctggggatatgcttcagccaggcaagaaatacaatttggattactacttggaaattgct
gaaaaaattgtccaaatgggcactcatatcctgggtatcaaagatatggcaggtaccatg
aagccagcagctgccaaactactgattggatctttgagggctaagtaccctgatctccca
atacatgttcacactcacgattctgcaggtactgctgttgcatcaatgactgcgtgtgct
ctggcgggcgccgatgtcgttgatgttgccatcaactcaatgtctggtttaacttcacaa
ccatcaatcaatgctctgttggcttcattagaaggtaatattgacactggtattaacgtt
gagcatgtccgtgaactagatgcatattgggcagagatgagattgttatactcttgtttc
gaggctgacttgaagggcccagatccagaagtttatcaacatgaaatcccaggtggtcaa
ttgacaaacttgttgtttcaagcccaacaattgggtcttggagaacaatgggccgaaaca
aaaagagcttacagagaagccaattatttattgggtgatattgtcaaagttaccccaact
tcgaaggtcgttggtgatctggcacaatttatggtctccaataaattaacttccgatgat
gtgagacgcctggctaattctttggatttccctgactctgttatggatttcttcgaaggc
ttaatcggccaaccatatggtgggttcccagaaccatttagatcagacgttttaaggaac
aagagaagaaagttgacttgtcgtccaggcctggaactagagccatttgatctcgaaaaa
attagagaagacttgcagaatagatttggtgatgttgatgagtgcgacgttgcttcttat
aacatgtacccaagagtttatgaagacttccaaaagatgagagaaacgtatggtgattta
tctgtattgccaacaagaagctttttgtctccactagagactgacgaagaaattgaagtt
gtaatcgaacaaggtaaaacgctaattatcaagctacaggctgtgggtgatttgaacaaa
aagaccggtgaaagagaagtttactttgatttgaatggtgaaatgagaaaaattcgtgtt
gctgacagatcacaaaaagtggaaactgttactaaatccaaagcagacatgcatgatcca
ttacacattggtgcaccaatggcaggtgtcattgttgaagttaaagttcataaaggatca
ctaataaagaagggccaacctgtagccgtattaagcgccatgaaaatggaaatgattata
tcttctccatccgatggacaagttaaagaagtgtttgtctctgatggtgaaaatgtggac
tcttctgatttattagttctattagaagaccaagttcctgttgaaactaaggcatga

DBGET integrated database retrieval system