KEGG   Saccharomyces cerevisiae (budding yeast): YJL130CHelp
Entry
YJL130C           CDS       T00005                                 

Gene name
URA2
Definition
bifunctional carbamoylphosphate synthetase/aspartate transcarbamylase (EC:2.1.3.2 6.3.5.5)
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sce00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sce00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
X:complement(165723..172367)
Genome map
AA seq 2214 aa AA seqDB search
MATIAPTAPITPPMESTGDRLVTLELKDGTVLQGYSFGAEKSVAGELVFQTGMVGYPESV
TDPSYEGQILVITYPLVGNYGVPDMHLRDELVEELPRYFESNRIHIAGLVISHYTDEYSH
YLAKSSLGKWLQNEGIPAVYGVDTRSLTKHLRDAGSMLGRLSLEKSGSDRTISRSSSWRS
AFDVPEWVDPNVQNLVSKVSINEPKLYVPPADNKHIELQTGPDGKVLRILAIDVGMKYNQ
IRCFIKRGVELKVVPWNYDFTKEDYDGLFISNGPGDPSVLDDLSQRLSNVLEAKKTPVFG
ICLGHQLIARAAGASTLKLKFGNRGHNIPCTSTISGRCYITSQNHGFAVDVDTLTSGWKP
LFVNANDDSNEGIYHSELPYFSVQFHPESTPGPRDTEFLFDVFIQAVKEFKYTQVLKPIA
FPGGLLEDNVKAHPRIEAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINP
NIATIQTSKGLADKVYFVPVTAEFVRKVILHERPDAIYVTFGGQTALSVGIAMKDEFEAL
GVKVLGTPIDTIITTEDRELFSNAIDEINEKCAKSQAANSVDEALAAVKEIGFPVIVRAA
YALGGLGSGFANNEKELVDLCNVAFSSSPQVLVEKSMKGWKEVEYEVVRDAFDNCITVCN
MENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPVSKD
YCIIEVNARLSRSSALASKATGYPLAYTAAKLGLNIPLNEVKNSVTKSTCACFEPSLDYC
VVKMPRWDLKKFTRVSTELSSSMKSVGEVMSIGRTFEEAIQKAIRSTEYANLGFNETDLD
IDIDYELNNPTDMRVFAIANAFAKKGYSVDKVWEMTRIDKWFLNKLHDLVQFAEKISSFG
TKEELPSLVLRQAKQLGFDDRQIARFLDSNEVAIRRLRKEYGITPFVKQIDTVAAEFPAY
TNYLYMTYNADSHDLSFDDHGVMVLGSGVYRIGSSVEFDWCAVTAVRTLRANNIKTIMVN
YNPETVSTDYDEADRLYFETINLERVLDIYEIENSSGVVVSMGGQTSNNIAMTLHRENVK
ILGTSPDMIDSAENRYKFSRMLDQIGVDQPAWKELTSMDEAESFAEKVGYPVLVRPSYVL
SGAAMNTVYSKNDLESYLNQAVEVSRDYPVVITKYIENAKEIEMDAVARNGELVMHVVSE
HVENAGVHSGDATLIVPPQDLAPETVDRIVVATAKIGKALKITGPYNIQFIAKDNEIKVI
ECNVRASRSFPFISKVVGVNLIELATKAIMGLPLTPYPVEKLPDDYVAVKVPQFSFPRLA
GADPVLGVEMASTGEVATFGHSKYEAYLKSLLATGFKLPKKNILLSIGSYKEKQELLSSV
QKLYNMGYKLFATSGTADFLSEHGIAVQYLEVLNKDDDDQKSEYSLTQHLANNEIDLYIN
LPSANRFRRPASYVSKGYKTRRLAVDYSVPLVTNVKCAKLLIEAISRNITLDVSERDAQT
SHRTITLPGLINIATYVPNASHVIKGPAELKETTRLFLESGFTYCQLMPRSISGPVITDV
ASLKAANSVSQDSSYTDFSFTIAGTAHNAHSVTQSASKVTALFLPLRELKNKITAVAELL
NQWPTEKQVIAEAKTADLASVLLLTSLQNRSIHITGVSNKEDLALIMTVKAKDPRVTCDV
NIYSLFIAQDDYPEAVFLPTKEDQEFFWNNLDSIDAFSVGALPVALANVTGNKVDVGMGI
KDSLPLLLAAVEEGKLTIDDIVLRLHDNPAKIFNIPTQDSVVEIDLDYSFRRNKRWSPFN
KDMNGGIERVVYNGETLVLSGELVSPGAKGKCIVNPSPASITASAELQSTSAKRRFSITE
EAIADNLDAAEDAIPEQPLEQKLMSSRPPRELVAPGAIQNLIRSNNPFRGRHILSIKQFK
RSDFHVLFAVAQELRAAVAREGVLDLMKGHVITTIFFEPSTRTCSSFIAAMERLGGRIVN
VNPLVSSVKKGETLQDTIRTLACYSDAIVMRHSEEMSVHIAAKYSPVPIINGGNGSREHP
TQAFLDLFTIREEIGTVNGITVTFMGDLKHGRTVHSLCRLLMHYQVRINLVSPPELRLPE
GLREELRKAGLLGVESIELTPHIISKTDVLYCTRVQEERFNSPEEYARLKDTYIVDNKIL
AHAKENMAIMHPLPRVNEIKEEVDYDHRAAYFRQMKYGLFVRMALLAMVMGVDM
NT seq 6645 nt NT seq  +upstreamnt  +downstreamnt
atggccactattgctcccactgctccaatcacccctccaatggaatctacgggtgaccgt
ctggttacgttggaacttaaggacggcacggtcttacaaggttattcatttggtgctgag
aaatccgtcgctggtgaattagttttccaaactggtatggttggttatcctgaatctgtg
accgatccatcttatgaaggccagatcttagtcatcacttacccattggtaggcaattat
ggtgtcccagatatgcacttgagagatgaattggtcgaagaattgccaagatattttgaa
agtaatagaatccatattgccggtttagttatttctcactataccgacgagtactctcat
tatcttgctaaatcttccttaggtaaatggttacaaaatgaagggatcccagctgtttat
ggtgttgatacaagatcattgaccaagcatttgagagatgcaggttcaatgttgggtagg
ttgtctttggaaaaaagcggctctgacagaaccatctccagatcttcctcttggagaagt
gcgtttgatgttcctgaatgggtggatccaaatgttcaaaacctagtttctaaggtctcc
atcaatgaacctaaattgtacgttcctccagcagacaataagcacatcgaattgcaaacc
ggacccgatggtaaagttttaaggattctagccattgacgtgggtatgaaatacaatcaa
attcgttgttttatcaaaaggggtgtagaattgaaagttgttccatggaactacgatttc
actaaagaagattatgatggtctgtttatttcaaatggtccaggtgatccatctgttcta
gatgatctatctcaaagattgtcaaatgtcctggaggctaaaaagacgccagtattcggt
atttgtctcggtcatcaattgatagcaagagctgccggtgcatccaccctaaaactaaaa
tttggtaaccgtggtcataacataccttgtacatcaactataagtggtcgttgttacata
acatctcaaaaccatgggttcgctgtggatgttgacactctaacttccggatggaagcca
ttgtttgttaacgcgaatgatgactctaacgaaggtatctatcattctgaattaccttat
ttttccgtccaattccatccagaatccacacctggcccaagagatacagaattcttgttt
gacgtttttatccaagcagttaaagaattcaagtatacacaagtgttgaaaccaatcgct
ttcccaggtggcctattagaggataacgttaaggcacaccctagaatcgaagcgaagaag
gttctagttctcggttctggtggtttgtccatcggtcaagctggtgaatttgactactct
ggttctcaagccatcaaagctttgaaagaagaaggtatctatacaattttaattaatcca
aacattgctaccatccaaacttcgaaagggttggctgataaggtttattttgttcctgtt
actgcagagttcgtgagaaaagttattttacatgaaaggccggacgccatttatgtgaca
tttggtggacaaactgctttatctgttggtatagccatgaaagatgaatttgaggcgtta
ggagttaaagtattgggtactccaatcgatactattattaccacggaagaccgtgaactc
ttcagtaatgccattgacgaaattaatgaaaaatgtgcgaaatctcaagctgctaattca
gtggacgaggcattggccgctgtcaaggagatcggtttcccagttattgtacgtgctgca
tatgcattgggaggtttaggttccggtttcgctaataatgaaaaagaattggttgatcta
tgtaatgttgcattttcatcctcacctcaagttttagtcgagaaatctatgaaaggttgg
aaagaagtcgaatatgaagttgttcgtgatgcttttgacaactgtattactgtttgtaat
atggaaaattttgatccactaggtattcacaccggtgattccatcgttgtagccccatct
caaactttatctgatgaagattacaatatgttaagaactactgctgttaatgttattaga
cacttaggtgttgttggtgaatgtaatatccaatatgctttaaatcccgtttctaaggat
tattgcatcattgaagttaatgcgcgtttgtcacgttcctctgctttagcttctaaggct
actggttacccattggcctacactgcggctaagttaggtttgaatatcccattaaatgaa
gttaagaattccgtcacaaaatccacatgtgcttgttttgaaccttctctagactactgt
gttgtcaaaatgccaagatgggatttgaagaagttcaccagagtttctaccgaattatct
tcatcaatgaaatctgttggtgaagttatgagcatcggtagaaccttcgaagaagctatt
caaaaagctatcagatccacagaatatgctaacctcggattcaatgagacagatctagat
atcgacattgattacgagttgaacaaccctacggatatgcgtgtcttcgccattgcaaat
gcttttgctaagaagggatattctgttgataaagtctgggaaatgactagaattgataag
tggtttttaaacaaactgcacgatttggtccaatttgctgagaaaattagttcatttggt
actaaagaggaattaccttccttagttttaagacaggctaagcagttaggttttgatgac
agacagattgcaagatttttggattccaacgaagttgccatccgtagattaagaaaagaa
tatggaattacaccatttgtcaaacaaattgatacagttgccgctgaattccccgcttac
acgaactatttatacatgacatacaatgctgactcacacgatttatcctttgatgaccac
ggtgttatggtcttgggttctggtgtttaccgtatcggttcttctgtcgaatttgattgg
tgtgctgttactgcagttagaacattacgtgccaacaatatcaaaactatcatggtcaac
tataatccagaaactgtttccacagattatgatgaggctgatagactatactttgaaacc
atcaaccttgaaagagttttggatatttacgagattgaaaactcaagcggtgttgtcgta
tcaatgggtggtcaaacttccaacaacatcgccatgactttacatcgtgaaaatgtaaag
attcttggtacatcccctgacatgattgattctgctgaaaaccgttacaagttctctcgt
atgttggatcaaattggtgttgaccaaccagcttggaaagaattgacatccatggacgaa
gctgaatcttttgccgaaaaggtgggttatccagttttggtacgtccatcttatgtgtta
tccggtgccgccatgaatactgtttattctaaaaacgatttggaatcctacttaaaccaa
gccgtcgaagtttcacgtgattatcctgttgttatcactaaatatattgaaaacgcaaag
gagattgaaatggatgcagttgcaagaaatggtgaattggttatgcatgttgtctctgag
catgttgaaaatgcaggtgtccactcgggtgatgcaacattaatcgttccacctcaagat
ttggctcctgaaactgtggatagaattgttgtcgccactgctaaaattggtaaggctttg
aaaattacaggtccatacaacatccaattcattgcaaaggacaatgaaatcaaggtcata
gaatgtaatgttcgtgcttcgagatctttcccattcatttcaaaggttgttggcgtcaat
ctgattgaattggcaacaaaggccataatgggtttgcctttgacgccttatcctgttgaa
aaattaccagatgattatgtcgccgttaaagtaccacaattctctttcccacgtttagca
ggagctgatccagtcttaggtgttgaaatggcctctactggtgaagtcgctacttttggc
cactcgaagtatgaagcatacttaaagtctttgttggcaaccggcttcaaacttccaaag
aagaatattttattgtctattggttcttacaaggaaaaacaagaattgctttcttccgta
caaaaactatacaacatgggatataaattatttgcaacatcaggtactgctgacttttta
tctgaacatggtattgccgtccaatatctggaggttttaaacaaggatgatgatgatcaa
aaatcagaatactcacttactcaacatttggctaataatgaaattgacctttacatcaac
ttgccttctgccaacaggttccgtcgtcctgcatcctatgtttcaaaggggtataaaaca
cgtcgtttggctgtcgattattcggttccgttggttactaacgttaaatgtgcaaaattg
ttgattgaagccatttcaagaaatatcactttagatgtttctgaacgtgatgcacaaact
tcccacagaactattaccttacctggtttaatcaatatcgcaacttatgttccgaatgca
tcccatgttatcaaaggcccagctgaactgaaggagaccacacgtctatttttggaatcc
ggttttacatactgtcaattgatgcccagatccatcagcggacctgttattactgacgtt
gcatccttgaaggccgcaaactctgtttcccaagattcatcttacactgacttttctttc
actattgctggtacagcacacaatgctcatagtgttacgcaatctgctagcaaagtgaca
gcattgtttttgcccctacgtgaattaaagaacaagatcacagcagtagctgaacttctg
aatcagtggccaactgaaaagcaagtgattgcagaagctaaaactgcagatttggcatcg
gttttattgttaacctcccttcaaaacagatctattcacattactggtgtttcgaataag
gaagatttagctttgatcatgacggtcaaggcaaaagaccctagagtgacttgtgatgtc
aatatttattctttgtttattgcccaagatgactatccggaggcagttttcttgcctact
aaggaagatcaagagtttttctggaacaaccttgatagtatcgatgctttctctgtcggt
gctcttcctgtcgccttggcaaatgtcacaggtaacaaggttgatgttggtatgggtatc
aaagattcattaccactattgttggctgctgttgaagaaggtaaattaaccattgatgat
atcgtccttcgtctgcatgacaatcccgctaaaattttcaacatccctactcaggactca
gttgtcgaaattgatttggattattctttcagacgtaataagagatggtcaccattcaac
aaagatatgaacggtggtattgagcgtgttgtctataatggcgaaacattagttttgagc
ggtgaattagtttcaccaggcgccaaaggaaaatgcattgttaatccaagtccagcttcc
ataactgcttccgcagagctccaatctactagtgctaaaagaaggttctcgatcacggaa
gaagcaatcgctgataatttagatgccgcggaggatgcaattccagaacagcctttggaa
caaaaattgatgtcttcaaggccaccaagagaacttgttgctccaggcgccatccagaat
ttgatccgtagtaacaatccattccgcggaagacatatattgtctatcaaacaattcaaa
cgttctgatttccatgtgttgtttgctgttgcacaagaactaagggcagctgtcgcaaga
gaaggtgtcttagatttaatgaaaggccacgttattactacaattttctttgaaccatct
actcgtacttgttcttcattcattgctgctatggaacgtttgggtggtagaattgtaaat
gttaatccattggtgtcttctgtcaagaaaggtgaaacccttcaagatactatcagaact
ttggcttgttacagtgatgccattgtcatgcgtcattcagaagaaatgtctgttcatatc
gccgctaaatattctcctgttccaattattaatggtggtaatggttctcgcgagcatcct
acgcaggccttcttggatttgtttacgattcgtgaagaaatcggtactgttaatggtatt
actgttactttcatgggtgatctcaaacatggtagaaccgtacattcattgtgtcgtttg
ttaatgcactatcaagtcagaattaatcttgtttctcctccggaattgaggttaccagaa
ggattaagagaagagctaagaaaagctggcttacttggtgttgagagcattgaattaacc
cctcatatcatctcaaagaccgatgttctgtattgtacaagggtccaagaagaaagattc
aatagccctgaagaatatgcacgtctgaaggatacttatatcgtggacaacaagatcttg
gcacacgccaaagaaaatatggctatcatgcatccattgcctcgtgtaaatgaaatcaaa
gaggaagtggactacgatcatcgtgctgcttacttcagacaaatgaagtatggtttgttc
gtcagaatggctttgttggccatggtcatgggtgttgatatgtga

DBGET integrated database retrieval system