KEGG   Saccharomyces cerevisiae (budding yeast): YLR079WHelp
Entry
YLR079W           CDS       T00005                                 

Gene name
SIC1, SDB25
Definition
Sic1p
Orthology
K03085  
substrate and inhibitor of the cyclin-dependent protein kinase CDC28
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:sce04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XII:286820..287674
Genome map
AA seq 284 aa AA seqDB search
MTPSTPPRSRGTRYLAQPSGNTSSSALMQGQKTPQKPSQNLVPVTPSTTKSFKNAPLLAP
PNSNMGMTSPFNGLTSPQRSPFPKSSVKRTLFQFESHDNGTVREEQEPLGRVNRILFPTQ
QNVDIDAAEEEEEGEVLLPPSRPTSARQLHLSLERDEFDQTHRKKIIKDVPGTPSDKVIT
FELAKNWNNNSPKNDARSQESEDEEDIIINPVRVGKNPFASDELVTQEIRNERKRAMLRE
NPDIEDVITYVNKKGEVVEKRRLTDEEKRRFKPKALFQSRDQEH
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgactccttccaccccaccaaggtccagagggactaggtaccttgcgcagcctagtggc
aatactagttctagtgccctaatgcaaggtcaaaagaccccccaaaagccttcacagaac
ctagtccctgtcactccctcaacaactaagtcttttaaaaatgcgccattattagcacct
cccaattcgaacatgggtatgacctctccatttaatgggcttacgtctcctcaacgctcg
ccgtttccaaaatcttcagtgaagaggacactattccaatttgaaagtcatgataatgga
acagtaagggaagagcaggaaccattgggtcgtgtaaataggatattgtttcccacgcag
caaaatgtggatatagatgcagcagaagaagaagaagaaggagaagttcttcttcccccc
agcagacctacatctgccaggcagttacatttatcacttgaaagagatgagtttgatcag
acacatagaaagaagattattaaagatgtacctggtacgcccagcgacaaggtgataaca
tttgaattggcaaaaaattggaacaacaactctccgaaaaatgacgccaggagtcaagaa
agtgaagacgaggaagacatcatcatcaatccagtgcgggtgggtaaaaatccctttgca
tcagatgaactggtcactcaggaaattagaaatgaacgtaaaagggcaatgttgagagaa
aacccagatatagaagacgtaataacatatgtcaataagaagggagaggtggtagagaaa
cgaaggttaacggatgaagaaaagagaagattcaagccaaaggcattgtttcaatctagg
gatcaagagcattga

DBGET integrated database retrieval system