KEGG   Saccharomyces cerevisiae (budding yeast): YMR001CHelp
Entry
YMR001C           CDS       T00005                                 

Gene name
CDC5, MSD2, PKX2
Definition
polo kinase CDC5 (EC:2.7.11.21)
Orthology
K06660  
cell cycle serine/threonine-protein kinase CDC5/MSD2 [EC:2.7.11.21]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YMR001C (CDC5)
   04113 Meiosis - yeast
    YMR001C (CDC5)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     YMR001C (CDC5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIII:complement(269019..271136)
Genome map
AA seq 705 aa AA seqDB search
MSLGPLKAINDKQLNTRSKLVHTPIKGNTADLVGKENHFKQTKRLDPNNDHHHQPAQKKK
REKLSALCKTPPSLIKTRGKDYHRGHFLGEGGFARCFQIKDDSGEIFAAKTVAKASIKSE
KTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE
VRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTIC
GTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSF
PRDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEAPNFEDIP
EEQSLVNFKDCMEKSLLLESMSSDKIQRQKRDYISSIKSSIDKLEEYHQNRPFLPHSLSP
GGTKQKYKEVVDIEAQRRLNDLAREARIRRAQQAVLRKELIATSTNVIKSEISLRILASE
CHLTLNGIVEAEAQYKMGGLPKSRLPKIKHPMIVTKWVDYSNKHGFSYQLSTEDIGVLFN
NGTTVLRLADAEEFWYISYDDREGWVASHYLLSEKPRELSRHLEVVDFFAKYMKANLSRV
STFGREEYHKDDVFLRRYTRYKPFVMFELSDGTFQFNFKDHHKMAISDGGKLVTYISPSH
ESTTYPLVEVLKYGEIPGYPESNFREKLTLIKEGLKQKSTIVTVD
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttgggtcctcttaaagctatcaatgataagcaattgaatacccgttccaagtta
gttcacaccccaataaagggaaataccgcagacctcgtaggaaaagaaaatcactttaaa
caaacaaagagactagatccgaataatgatcatcaccaccagccagctcaaaaaaagaaa
agggaaaagttatcagctttgtgtaaaacaccaccttcattaatcaaaacaagaggaaaa
gactatcaccgaggtcattttttaggtgaaggtggatttgctcgctgtttccaaattaag
gacgattcaggcgaaatttttgctgccaaaacagttgctaaagcctcaattaaatcagag
aagacaagaaaaaagttgttgtcggagattcaaattcataaaagtatgtcccatccaaat
atcgttcagtttattgattgttttgaggatgatagcaatgtctatatcttattggagata
tgccccaacggttcattaatggaattactaaaaagaagaaaagttttaacagaaccagaa
gttagatttttcaccactcaaatatgtggtgcaattaagtatatgcattcaagaagagtt
atacatagagatttaaaacttggtaacatcttcttcgattcaaactataacttaaagatt
ggtgacttcggtctggcagctgtgttggcgaatgaaagtgaacgtaaatacaccatatgc
ggaacacctaattacatcgcacctgaagtgttgatgggtaagcattctggacattcattt
gaagtagatatttggtcattaggtgttatgctttatgctttgttgattggtaagccaccc
ttccaagcaagagatgtaaacactatttatgaaagaatcaaatgtcgtgatttttcgttt
ccaagagataaaccaatctcagatgaaggtaagattttaataagagacattctatcctta
gatccaatagaaaggccctctttgactgaaattatggattatgtatggtttaggggaact
ttcccaccatctattccttcgacggtcatgtcagaagcaccaaattttgaggatattcct
gaagagcagtcactggttaacttcaaagattgcatggaaaaatctctactattagaaagc
atgagcagcgataaaattcagcgtcaaaagagggattatatttcttcaattaaatctagt
atcgataaactagaagagtaccaccaaaacagaccatttttaccacattctttatcccct
ggcgggacgaaacagaaatataaggaggttgttgatatagaggcacaaagaagattaaac
gatttggctcgtgaagcaaggatacgtagagcacaacaggccgttttgagaaaagaatta
atagctacatcgaccaatgtcattaaatcagaaatctccttgagaatattagccagtgag
tgtcatcttactttgaatggcattgtagaagcagaagctcagtataaaatgggaggtctt
ccgaaatcaagattgcctaaaattaaacacccaatgatagttaccaagtgggtcgactac
tccaacaaacacggattctcctatcagttatcaacagaggatattggtgtcttatttaat
aatggcaccacagttctccgattggcagatgcagaagagttttggtatattagttatgac
gatcgggaaggttgggtagcaagtcattatttattgagcgaaaaaccacgagagctaagt
agacatttagaagtagttgatttttttgccaagtacatgaaggcaaatttgagccgagta
tctacgtttggcagagaagaatatcataaagatgatgtatttttgagaagatacacaagg
tataaaccatttgttatgtttgaactaagtgatggtactttccagttcaatttcaaagat
catcataaaatggcaatatccgacggaggtaaattggtgacctacatttctccctcccat
gaaagcaccacatatcccttagttgaagtactaaaatatggcgagatcccaggatatcca
gaaagtaactttagagagaaactaactttgataaaggaaggtttgaagcagaagtccaca
attgttaccgtagattaa

DBGET integrated database retrieval system