KEGG   Saccharomyces cerevisiae (budding yeast): YOL086CHelp
Entry
YOL086C           CDS       T00005                                 

Gene name
ADH1, ADC1
Definition
alcohol dehydrogenase ADH1 (EC:1.1.1.190 1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    YOL086C (ADH1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YOL086C (ADH1)
  Lipid metabolism
   00071 Fatty acid degradation
    YOL086C (ADH1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    YOL086C (ADH1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     YOL086C (ADH1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XV:complement(159548..160594)
Genome map
AA seq 348 aa AA seqDB search
MSIPETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVK
LPLVGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLSGY
THDGSFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVYKALKSANLMAGHWVAISGAA
GGLGSLAVQYAKAMGYRVLGIDGGEGKEELFRSIGGEVFIDFTKEKDIVGAVLKATDGGA
HGVINVSVSEAAIEASTRYVRANGTTVLVGMPAGAKCCSDVFNQVVKSISIVGSYVGNRA
DTREALDFFARGLVKSPIKVVGLSTLPEIYEKMEKGQIVGRYVVDTSK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcccagaaactcaaaaaggtgttatcttctacgaatcccacggtaagttggaa
tacaaagatattccagttccaaagccaaaggccaacgaattgttgatcaacgttaaatac
tctggtgtctgtcacactgacttgcacgcttggcacggtgactggccattgccagttaag
ctaccattagtcggtggtcacgaaggtgccggtgtcgttgtcggcatgggtgaaaacgtt
aagggctggaagatcggtgactacgccggtatcaaatggttgaacggttcttgtatggcc
tgtgaatactgtgaattgggtaacgaatccaactgtcctcacgctgacttgtctggttac
acccacgacggttctttccaacaatacgctaccgctgacgctgttcaagccgctcacatt
cctcaaggtaccgacttggcccaagtcgcccccatcttgtgtgctggtatcaccgtctac
aaggctttgaagtctgctaacttgatggccggtcactgggttgctatctccggtgctgct
ggtggtctaggttctttggctgttcaatacgccaaggctatgggttacagagtcttgggt
attgacggtggtgaaggtaaggaagaattattcagatccatcggtggtgaagtcttcatt
gacttcactaaggaaaaggacattgtcggtgctgttctaaaggccactgacggtggtgct
cacggtgtcatcaacgtttccgtttccgaagccgctattgaagcttctaccagatacgtt
agagctaacggtaccaccgttttggtcggtatgccagctggtgccaagtgttgttctgat
gtcttcaaccaagtcgtcaagtccatctctattgttggttcttacgtcggtaacagagct
gacaccagagaagctttggacttcttcgccagaggtttggtcaagtctccaatcaaggtt
gtcggcttgtctaccttgccagaaatttacgaaaagatggaaaagggtcaaatcgttggt
agatacgttgttgacacttctaaataa

DBGET integrated database retrieval system