KEGG   Saccharomyces cerevisiae (budding yeast): YPL268WHelp
Entry
YPL268W           CDS       T00005                                 

Gene name
PLC1
Definition
(RefSeq) phosphatidylinositol phospholipase C
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00562  Inositol phosphate metabolism
sce01100  Metabolic pathways
sce04070  Phosphatidylinositol signaling system
sce04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    YPL268W (PLC1)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    YPL268W (PLC1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    YPL268W (PLC1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     YPL268W (PLC1)
Membrane trafficking [BR:sce04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    YPL268W (PLC1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    YPL268W (PLC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_1 C2 EF-hand_6 EF-hand_7
Motif
Other DBs
NCBI-GeneID: 855860
NCBI-ProteinID: NP_015055
SGD: S000006189
UniProt: P32383
Position
XVI:35236..37845
Genome map
AA seq 869 aa AA seqDB search
MTESAIDDQRFNLTKELQRHSCRDQGKITQKDDALDFISYSSFQSSFNTDQKSANNGSTV
RRSIRSIFRRAAELPRVHMGPLTYSHGINELVNKKLRKDCDLSTLCRVLQRGIRMIRMTR
RRRKFYEFKLINNNGQIIWKDGSKYLELDSVKDIRIGDTASTYQEEVDPKRLRSDSKLWI
AIIYKVSNKLKALHVVALNELDFNTFLSCICGLVKLRRELMESILLPDNSQFARIHWQIT
VSEKEEDEKKDTLSFADVKKLCDKFHIYVSTGQLLEFFQLADINHNGLLNYFEFEKFIKI
LKNRKEVNMIWSKFTKPPHSHLSFENFFQFLITEQHEQVDRQTAWSYFIKYREPTQLTMG
QDGFTKFLKEQPYLVEVKEELYSKPLNHYFIASSHNTYLLGKQIAETPSVEGYIQVLQQG
CRCVEIDIWDGENGPVVCHGFLTSAIPLKTVIRVIKKYAFITSPYPLIISLEINCNKDNQ
KLASLIMREVLAEQLYFVGTRTDKLPSPRELKHKILLKSKKTSEATRGLSVNEPFPSSFS
SSYESANEQELRMKDDSTNSSSATNSSSMQRIKRIGLKKHADIINDVSNISGIHGIKFRN
FSLPESKTIAHCFSLNERKVEYMIKDKHLKLSLDKHNRRYLMRVYPHVLRYKSSNFNPIP
FWKAGVQMVATNWQTNDIGQQLNLAMFQILDHQPDGSFKSGYVLKPKKLLPVVTKAKMIP
LIYEHFENGSDPVTVKIRILSTQLLPRLNDTSPSRNNTNSFVKVEFHTDDEPTMPISIDK
GTRISATEASTKSSQGNGFNPIWDAEVSITLKDTDLTFIKFMVISEETQIASVCLKLNYL
RMGYRHIPLFNMEGEQYIFCTLFIHTQIL
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaagtgctatagatgaccaaaggtttaatcttacaaaggagttacaacgacac
tcatgcagagatcaagggaaaataacacaaaaggatgatgctttagattttataagttac
agttcttttcaatcctcttttaatactgaccaaaaaagcgcgaacaatggaagtactgtg
agaagaagcataaggtcgatttttagaagagcagccgaattgcctagagtccatatgggg
cctcttacttattcacatgggataaatgagcttgttaacaagaaattaagaaaagactgt
gatctcagcacgctatgtcgcgtattgcaaagaggaatcaggatgattaggatgacaaga
agaagaaggaagttctatgaatttaaattaatcaataacaacgggcaaataatatggaaa
gatggttcgaagtatctggaattagactccgttaaagacatcagaatcggtgatacggcg
agtacttatcaagaggaagtagatccgaaaagattgagatcggacagtaaactttggatt
gctattatttataaggtttccaacaaattgaaagcgttacacgtagttgctttgaatgaa
ttggactttaacacattcttaagctgcatttgcggtttagtgaagttaaggagggaatta
atggaaagcatacttttgcctgataattcgcaattcgctaggatacattggcaaattact
gtttctgaaaaagaggaagatgagaaaaaggacacattgagctttgcagatgtgaagaaa
ctatgtgataaatttcatatttatgtgtcaactggtcaattgttagagtttttccaatta
gcagacatcaatcataacggactattaaattattttgaatttgaaaagttcattaaaatc
ttaaagaataggaaagaggtaaatatgatttggtctaaatttacaaaacctccacactcc
cacttatcatttgaaaatttttttcaatttttaattacagagcagcatgagcaagtggat
cgtcaaactgcatggtcatattttattaagtacagagaaccgactcagctgacgatgggg
caagatggttttaccaagttcttgaaggagcaaccatatttggtggaggttaaagaggag
ttatattcaaagccattaaaccattattttattgcatcttcacataatacttatttattg
gggaaacaaattgcagaaactccatctgtggagggatatattcaagtcctacaacaaggt
tgtaggtgcgtagaaattgatatatgggatggtgaaaatgggccagtggtatgccatgga
tttttaacgtcagctattcccttaaaaacagttatacgcgtgataaagaagtacgctttt
ataacgtctccgtatcctttgattatttcactggaaataaactgtaacaaggataatcaa
aaattggcaagcctgataatgagagaggttttagcagaacagctgtactttgttggcaca
agaactgataaactgccatcaccaagggaattaaaacataaaatactgttgaaatccaag
aagacgagtgaagcaactagaggtcttagcgttaatgagccatttccatcttcttttagt
tcttcttacgaatcagctaatgaacaggaattaagaatgaaagatgactccacgaacagt
agtagcgcaacaaattcttctagtatgcaacgcatcaaaagaattggattaaaaaagcac
gctgatataattaatgatgtttctaacatttctggaatacatggcatcaagttcaggaat
ttctctttaccagagtccaaaacgatagcgcattgtttttcactgaatgagcgcaaagta
gaatacatgataaaagacaaacacttaaaattatcgttggataaacataatagaagatat
ttgatgagagtctatcctcacgttttacgatacaaatcatcaaattttaacccaatacct
ttttggaaggccggtgtacaaatggtggctacgaattggcaaactaatgatattggacag
caacttaatctggcaatgtttcaaatattagatcaccaacctgatggaagttttaaatca
ggatacgtgctaaaaccaaaaaagttgctacctgtagtaacaaaggcgaaaatgattcca
ttaatttacgaacattttgaaaatggtagtgatcctgttactgttaaaattcgaatttta
tctacacagttattgcccagattgaatgatacatcgccaagcagaaataacaccaattcc
tttgttaaagtggagtttcataccgatgacgagccgacaatgcccatctcaatcgataag
ggtacaaggatttctgccactgaagcatccactaagagttctcaagggaatggattcaac
ccaatatgggatgctgaagtttctatcacattgaaagatacagacctcacatttataaaa
ttcatggttatctctgaagagacccagattgcatctgtttgccttaagctgaactatttg
aggatgggatatcgtcacattccgttgtttaacatggagggggaacaatacatattttgc
actttatttattcatacacaaattttatag

DBGET integrated database retrieval system