KEGG   Saccharomyces cerevisiae (budding yeast): YPL268WHelp
Entry
YPL268W           CDS       T00005                                 

Gene name
PLC1
Definition
phosphatidylinositol phospholipase C (EC:3.1.4.11)
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    YPL268W (PLC1)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    YPL268W (PLC1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     YPL268W (PLC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:35236..37845
Genome map
AA seq 869 aa AA seqDB search
MTESAIDDQRFNLTKELQRHSCRDQGKITQKDDALDFISYSSFQSSFNTDQKSANNGSTV
RRSIRSIFRRAAELPRVHMGPLTYSHGINELVNKKLRKDCDLSTLCRVLQRGIRMIRMTR
RRRKFYEFKLINNNGQIIWKDGSKYLELDSVKDIRIGDTASTYQEEVDPKRLRSDSKLWI
AIIYKVSNKLKALHVVALNELDFNTFLSCICGLVKLRRELMESILLPDNSQFARIHWQIT
VSEKEEDEKKDTLSFADVKKLCDKFHIYVSTGQLLEFFQLADINHNGLLNYFEFEKFIKI
LKNRKEVNMIWSKFTKPPHSHLSFENFFQFLITEQHEQVDRQTAWSYFIKYREPTQLTMG
QDGFTKFLKEQPYLVEVKEELYSKPLNHYFIASSHNTYLLGKQIAETPSVEGYIQVLQQG
CRCVEIDIWDGENGPVVCHGFLTSAIPLKTVIRVIKKYAFITSPYPLIISLEINCNKDNQ
KLASLIMREVLAEQLYFVGTRTDKLPSPRELKHKILLKSKKTSEATRGLSVNEPFPSSFS
SSYESANEQELRMKDDSTNSSSATNSSSMQRIKRIGLKKHADIINDVSNISGIHGIKFRN
FSLPESKTIAHCFSLNERKVEYMIKDKHLKLSLDKHNRRYLMRVYPHVLRYKSSNFNPIP
FWKAGVQMVATNWQTNDIGQQLNLAMFQILDHQPDGSFKSGYVLKPKKLLPVVTKAKMIP
LIYEHFENGSDPVTVKIRILSTQLLPRLNDTSPSRNNTNSFVKVEFHTDDEPTMPISIDK
GTRISATEASTKSSQGNGFNPIWDAEVSITLKDTDLTFIKFMVISEETQIASVCLKLNYL
RMGYRHIPLFNMEGEQYIFCTLFIHTQIL
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaagtgctatagatgaccaaaggtttaatcttacaaaggagttacaacgacac
tcatgcagagatcaagggaaaataacacaaaaggatgatgctttagattttataagttac
agttcttttcaatcctcttttaatactgaccaaaaaagcgcgaacaatggaagtactgtg
agaagaagcataaggtcgatttttagaagagcagccgaattgcctagagtccatatgggg
cctcttacttattcacatgggataaatgagcttgttaacaagaaattaagaaaagactgt
gatctcagcacgctatgtcgcgtattgcaaagaggaatcaggatgattaggatgacaaga
agaagaaggaagttctatgaatttaaattaatcaataacaacgggcaaataatatggaaa
gatggttcgaagtatctggaattagactccgttaaagacatcagaatcggtgatacggcg
agtacttatcaagaggaagtagatccgaaaagattgagatcggacagtaaactttggatt
gctattatttataaggtttccaacaaattgaaagcgttacacgtagttgctttgaatgaa
ttggactttaacacattcttaagctgcatttgcggtttagtgaagttaaggagggaatta
atggaaagcatacttttgcctgataattcgcaattcgctaggatacattggcaaattact
gtttctgaaaaagaggaagatgagaaaaaggacacattgagctttgcagatgtgaagaaa
ctatgtgataaatttcatatttatgtgtcaactggtcaattgttagagtttttccaatta
gcagacatcaatcataacggactattaaattattttgaatttgaaaagttcattaaaatc
ttaaagaataggaaagaggtaaatatgatttggtctaaatttacaaaacctccacactcc
cacttatcatttgaaaatttttttcaatttttaattacagagcagcatgagcaagtggat
cgtcaaactgcatggtcatattttattaagtacagagaaccgactcagctgacgatgggg
caagatggttttaccaagttcttgaaggagcaaccatatttggtggaggttaaagaggag
ttatattcaaagccattaaaccattattttattgcatcttcacataatacttatttattg
gggaaacaaattgcagaaactccatctgtggagggatatattcaagtcctacaacaaggt
tgtaggtgcgtagaaattgatatatgggatggtgaaaatgggccagtggtatgccatgga
tttttaacgtcagctattcccttaaaaacagttatacgcgtgataaagaagtacgctttt
ataacgtctccgtatcctttgattatttcactggaaataaactgtaacaaggataatcaa
aaattggcaagcctgataatgagagaggttttagcagaacagctgtactttgttggcaca
agaactgataaactgccatcaccaagggaattaaaacataaaatactgttgaaatccaag
aagacgagtgaagcaactagaggtcttagcgttaatgagccatttccatcttcttttagt
tcttcttacgaatcagctaatgaacaggaattaagaatgaaagatgactccacgaacagt
agtagcgcaacaaattcttctagtatgcaacgcatcaaaagaattggattaaaaaagcac
gctgatataattaatgatgtttctaacatttctggaatacatggcatcaagttcaggaat
ttctctttaccagagtccaaaacgatagcgcattgtttttcactgaatgagcgcaaagta
gaatacatgataaaagacaaacacttaaaattatcgttggataaacataatagaagatat
ttgatgagagtctatcctcacgttttacgatacaaatcatcaaattttaacccaatacct
ttttggaaggccggtgtacaaatggtggctacgaattggcaaactaatgatattggacag
caacttaatctggcaatgtttcaaatattagatcaccaacctgatggaagttttaaatca
ggatacgtgctaaaaccaaaaaagttgctacctgtagtaacaaaggcgaaaatgattcca
ttaatttacgaacattttgaaaatggtagtgatcctgttactgttaaaattcgaatttta
tctacacagttattgcccagattgaatgatacatcgccaagcagaaataacaccaattcc
tttgttaaagtggagtttcataccgatgacgagccgacaatgcccatctcaatcgataag
ggtacaaggatttctgccactgaagcatccactaagagttctcaagggaatggattcaac
ccaatatgggatgctgaagtttctatcacattgaaagatacagacctcacatttataaaa
ttcatggttatctctgaagagacccagattgcatctgtttgccttaagctgaactatttg
aggatgggatatcgtcacattccgttgtttaacatggagggggaacaatacatattttgc
actttatttattcatacacaaattttatag

  All links  
No link information was found.   
DBGET integrated database retrieval system