KEGG   Sorangium cellulosum So ce 56: sce0257Help
Entry
sce0257           CDS       T00634                                 

Gene name
recR
Definition
DNA repair and genetic recombination protein
Orthology
K06187  
recombination protein RecR
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:scl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    sce0257 (recR)
DNA repair and recombination proteins [BR:scl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      sce0257 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(367522..368238)
Genome map
AA seq 238 aa AA seqDB search
MTALRSPSSLPGSSKVPNGDRSAPAAGFRSAPGGLPGRLSRVAQLLARLPGVGEKTAQRF
ALFLVTAGEDTARDLGGELVELCDHIRPCIRCGHIAELDDGGRALCAICLDTRRDGALLC
VVARVQDLLAIERSGAMRGRYFVLGRLLSPLEGVGAEELPLEALRARVRDPEQPVREVLV
ATPPSVDGEATALLLARELGAMGIQVTRIASGVPHGGDLEFADQVTLGRAIEGRKSFG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
ttgacggcgttgcgctccccgtcgtcgctccccggctcctcgaaggtcccgaacggcgac
cggagcgcgcccgcggccggcttccggagcgcgcccggcggcctgcccggccggctgtcg
cgggtcgcccagctgctcgcgcgcctgccgggcgtcggcgagaagacggcgcagcgcttc
gccctcttcctcgtgaccgccggcgaggacaccgcgcgcgacctggggggcgagctcgtc
gagctctgcgatcacatcaggccgtgcatccggtgcggccacatcgccgagctcgacgac
ggcggccgggcgctctgcgccatctgcctggatacgcggcgcgacggcgcgctcctgtgc
gtggtcgcgcgcgtccaggacctcctggcgatcgagcggagcggggcgatgcgcgggcgg
tacttcgtgctcggccggctcctctcgccgctcgagggggtcggcgccgaggagctgccg
ctcgaggcgctccgggcgcgcgtgcgcgatcccgagcagccggtgagggaggtgctggtc
gccaccccgccttccgtcgacggagaggcgaccgcgctcctgctcgcgcgggagctcggc
gcgatggggatccaggtcacgcggatcgccagcggcgtgccgcacgggggagatctggag
ttcgccgaccaggtgacgctggggcgagccatcgaaggccggaagagcttcggctag

DBGET integrated database retrieval system