KEGG   Sorangium cellulosum So ce 56: sce8213Help
Entry
sce8213           CDS       T00634                                 

Gene name
galM1
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:scl00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:scl00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11434728..11435717
Genome map
AA seq 329 aa AA seqDB search
MNIRRTTIGTTAGHAGQGPTRVDAYSLDTEKGLAVTVWTYGATLVELLVPDRDGRVDNVV
VRLPDLESYEDRSKNPYIGSTLGRFARAVAGGRFELDGVEHQLDRNYGRHHFHGGSIGFD
RFVWSADAERRQGELALRLRLERPDGDQGYPGALSAEVTYRVDGDGRLTLDYRATTTAST
IVAFTNHAFWNLAGSGTIDDHRLALNAARVLACDEELIPRGPPAGVAGTRLDYRAPRQIG
DARIDDCFVLDDPTWAAELFEPSTGRRMRVVTDQPGLAVYSGDGLAGPRAGLCLQTGAFP
DAPNRADFPSARLDPGMTHRHSTTHAFSR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccggcggacgacgatcggcaccaccgcggggcacgccgggcaaggccccacc
cgcgtcgatgcgtactcgctcgacacggagaaggggctcgccgtgaccgtgtggacctac
ggggcgacgctcgtcgagctgctcgtccccgatcgcgacggccgggtcgacaacgtcgtc
gttcgcctcccggacctcgagagctacgaggatcgatcgaagaacccttacatcgggtcc
acgctcggccgcttcgcgcgcgccgtcgcgggggggcggttcgagctcgacggggtcgag
caccagctcgatcgcaactacggccggcatcacttccacgggggaagcatcgggttcgat
cgattcgtgtggagcgccgacgccgagcgccgccagggcgagctcgcgctccggctccgg
ctcgagcgccccgacggcgaccagggttaccccggcgcgctgtcggccgaggtcacctat
cgagtcgacggcgacggtcggctcacgctcgactatcgggcgaccaccacggcgagcacc
atcgtggcgttcaccaatcacgccttctggaacctcgccggctcgggcaccatcgacgat
caccggctcgcgctcaacgcggcgcgcgtcctcgcgtgcgacgaagagctgatcccgcgg
ggcccgcccgccggcgtcgccggtacgcggctcgattaccgggcgccgcggcagatcggc
gatgcgcggatcgacgactgcttcgtgctcgacgatccgacgtgggccgcggagctcttc
gagccctcgaccggccggcgaatgcgggtcgtcaccgatcagccggggctcgcggtctac
tcgggcgacggcctcgccgggccacgcgcggggctgtgcctgcagacaggcgccttcccc
gacgcgcccaaccgcgctgatttcccctcggcgcggctcgatcccgggatgacccatcgc
cactccacgacccacgcgttctcgaggtga

DBGET integrated database retrieval system