KEGG   Streptomyces coelicolor: SCO2144Help
Entry
SCO2144           CDS       T00085                                 

Gene name
SC6G10.17
Definition
(RefSeq) integral membrane transporter
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
2304481..2305890
Genome map
AA seq 469 aa AA seqDB search
MNLRLAAALCAALSLCAVLAVPANFPALGGDARLTLAVFALATCAWIGTPIDDTYIALGA
GLALTATGVISSDTLFGTLGEDTVWLLICAFVLAAAVARTGLAGRAAAFLVGGARTVRQL
VHLTTAALVVTAFAMPATSGRAALALPVFLALAKVLADRKRLVVMLALLFPTVILLSAVA
TLIGAGAHLITVSVLWEATGDRIGFTQWLLLGLPLAVASSHLAAETVLLTTTRRADRAGP
VRITAEEIQRHSESPVTGPWTQAEKRCALLLATVVALWCSEPLHRVSPAVVALIGAVVAS
SPALGTVRLKDALKTVPWSLLLFMAATMAMGVALADSGAAGWLVSGLPADVAPAVFLGVV
VAVSTAAHLVLQSRSARSSVLVPLVIAAAVGAGVNPVAAALASTAAAGFCHTLPASAKPV
TLFSDVPGVPTYTPRDLLRLSAVLAPLTALLVLFFAAAVWPLLGVPVTR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
ttgaacctccgcctcgcggcggccctgtgcgcggcgctgtccctgtgcgccgtgctggcg
gtccccgccaacttccccgccctgggcggcgacgcgcgcctgaccctcgccgtgttcgcg
ctggccacctgtgcctggatcggtacgccgatcgacgacacgtacatcgcgctgggcgcc
gggctcgcgctgaccgcgaccggtgtcatcagcagcgacaccctgttcggcaccctcggt
gaggacacggtgtggctgctgatctgcgccttcgtgctggccgccgcggtcgccaggacc
gggctcgcggggcgggcggcggcgttcctggtgggcggggcgcgcacggtgcggcagctg
gtgcacctgacgacggccgcgctggtcgtcacggccttcgcgatgccggccacctccggc
cgggcggcgctggcgctgccggtgttcctcgccctcgccaaggtgctcgccgaccggaag
cgactggtcgtgatgctggcgctgctgttcccgaccgtgatcctgctgtcggcggtggcg
accctgatcggagccggtgcgcatctgatcacggtgtcggtgctgtgggaggcgaccggg
gaccggatcgggttcacccagtggctgctgctcggcctgccgctggcggtcgcctcctcc
cacctcgccgccgagacggtcctgctgacgaccacgcggcgcgcggaccgcgcgggcccg
gtccgcatcaccgccgaggagatacagcggcacagcgagagcccggtcaccggcccctgg
acgcaggccgagaagcgctgcgcgctgctgctggccacggtggtggccctgtggtgcagc
gagcccctgcaccgggtctcccccgcagtggtggcgctgatcggcgcggtcgtcgcctcc
tcccccgcgctgggcaccgtacggctcaaggacgcgctgaagaccgtgccgtggtccctg
ctgctgttcatggcggcgacgatggcgatgggcgtcgcgctggccgactccggtgcggcg
ggatggctggtgtcgggcctgcccgcggacgtcgccccggccgtcttcctcggcgtggtg
gtcgcggtgagcacggcggcccacctggtcctccagtcccgttccgcccgctcctcggtg
ctggtcccgctggtgatcgccgcggccgtcggcgccggggtcaacccggtcgccgccgcg
ctcgcctcgacggcggcggccgggttctgccacacgctcccggcctccgccaagccggtc
acgctcttctccgacgtgcccggcgtccccacctacaccccgcgcgacctgctgcggctg
tccgccgtgctggcgccgctgaccgccctgctcgtgctgttcttcgccgccgcggtctgg
ccgctgctcggcgtgcccgtgacccgctga

DBGET integrated database retrieval system