KEGG   Streptomyces coelicolor: SCO5246Help
Entry
SCO5246           CDS       T00085                                 

Gene name
2SC7G11.08
Definition
(RefSeq) Na+/H+ antiporter
  KO
K03316  
monovalent cation:H+ antiporter, CPA1 family
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
5706075..5707667
Genome map
AA seq 530 aa AA seqDB search
MDVMPLLLLVAGSAAVAAAGRRVPVPVPLLLVAAGLAVSYVPGVPDYTLDPHIVLPLLLP
PLLYTAATDSSYLDLRAQARPVALLSVGYVLFATFVVGCAAYLIVPGLPLTAALVLGAVV
APPDAVAATAVARRVGLPSRITTILQGESLVNDATAITAFKVALAAAVGEGATWAGGIGE
FLIAAVGGVGVGLVLMVPLHWLRTHLTEALLQNTLSLLIPFVAYAVAEQVQASGVLAVVV
VALYLGHRAWEVDFATRLQEEAVWKMVAFVLESAVFALIGLQLPVVLKGLGEYEGADAAW
YALAVFLVVAVARFVWVYPATYLPRLSARVRAREGELSWKGPFVIGWAGMRGVVSLAIAF
SIPLTVHGGEPFPERNLILFLTFTTVIGTLVVQGVSLPPLIRLLKFPAHDVQAETLAEAN
AQAQASRVAELRLDDLLADERNALPAPLADRLRMVLERRRNAVWERLGQVNPVTGETVDD
TYRRLSREMISAEREVFVRLRDGRYIDDEMLRTLLRRLDLEEAAAYREAT
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgatgccgctgctgttgctggtggcgggcagcgccgcggtcgccgcggcggga
cggcgcgtaccggtgccggtgccgctgctcctggtcgcggccggcctggcggtgagctat
gtgcccggtgtgcccgactacaccctcgacccgcacatcgtcctgcccctgctgctgccc
ccgctgctctacacggcggccaccgacagctcctacctggacctgcgggcgcaggcccgg
cccgtggcgctgctgtccgtgggctacgtcctgttcgccaccttcgtcgtcggctgcgcg
gcgtacctcatcgtgccgggcctgccgctgaccgcggccctggtcctcggcgcggtcgtg
gcgcccccggacgccgtcgcggccacggcggtcgcccgccgcgtggggctgccctcccgg
atcaccacgatcctccagggcgagtccctggtgaacgacgccaccgcgatcaccgccttc
aaggtggcgctcgccgcggccgtcggcgagggggcgacctgggccggcgggatcggcgag
ttcctcatcgcggcggtgggcggcgtcggcgtcgggctggtgctgatggtgccgctgcac
tggctgcgcacccacctgacggaggcgctgctgcagaacacgctctccctgctgatcccg
ttcgtcgcctacgcggtcgccgagcaggtgcaggcctccggggtgctcgcggtggtcgtc
gtcgcgctctacctcggccaccgcgcgtgggaggtcgacttcgccacccggctccaggag
gaggcggtgtggaagatggtcgcgttcgtcctggagtcggcggtgttcgccctcatcgga
ctccagctgcccgtcgtcctcaaaggcctgggggagtacgagggtgccgacgccgcctgg
tacgccctcgccgtcttcctggtggtcgccgtggcgaggttcgtgtgggtgtacccggcg
acctacctgccccggctgtcggcacgggtacgcgcgcgcgagggcgagctctcctggaag
gggccgttcgtgatcggctgggccgggatgcggggcgtggtctccctggccatcgccttc
tccatcccgctcaccgtgcacgggggcgagccctttcccgagcgcaacctcatcctgttc
ctgaccttcaccacggtcatcggcacgctggtcgtccaaggcgtcagcctgccgccgctg
atccgcctgctgaagttcccggcgcacgacgtgcaagcggagacgctggcggaggccaac
gcacaggcgcaggcctcacgggtcgcggaactgcgcctggacgacctgctcgccgacgag
cgcaacgctcttccggcgccgctcgccgaccgcctccgcatggtcctggagcgccgccgc
aacgccgtctgggaacggctcggccaggtcaatcccgtcaccggcgagaccgtcgacgac
acctaccggcgactctcccgggagatgatcagcgccgagcgcgaggtcttcgtcaggctc
cgggacggccgctacatcgacgacgagatgctccggaccctgctgcgccggctggacctg
gaggaggccgccgcgtaccgggaggcgacgtga

DBGET integrated database retrieval system