KEGG   Streptomyces coelicolor: SCO5553Help
Entry
SCO5553           CDS       T00085                                 

Gene name
leuC
Definition
(RefSeq) 3-isopropylmalate dehydratase large subunit
  KO
K01703  
3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
sco  Streptomyces coelicolor
Pathway
Valine, leucine and isoleucine biosynthesis
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SCO5553 (leuC)
   01230 Biosynthesis of amino acids
    SCO5553 (leuC)
  Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    SCO5553 (leuC)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SCO5553 (leuC)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     SCO5553 (leuC)
    4.2.1.35  (R)-2-methylmalate dehydratase
     SCO5553 (leuC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
6052013..6053443
Genome map
AA seq 476 aa AA seqDB search
MGRTLAEKVWDDHVVRRAEGEPDLLFIDLHLLHEVTSPQAFDGLRKSGRPVRRLDLTIAT
EDHNTPTLDIDKPIADPVSRAQLETLRKNCADFGVRLHPLGDVEQGVVHVVGPQLGLTQP
GTTVVCGDSHTSTHGAFGALAFGIGTSQVEHVLATQTLPLARPKTMAITVDGELPEGVTA
KDLILAIIARIGTGGGQGYILEYRGEAIEKLSMEARMTICNMSIEAGARAGMIAPDETTF
AYLQGRPHAPEGADWDAAVEYWKTLRTDDDAEFDAEVVIEAAELAPFVTWGTNPGQGAPL
SAAVPDPASYEDASERFAAEKALEYMGLEAGQPLRSIQVDTVFVGSCTNGRIEDLRAAAE
IVRDRKVADGVRMLVVPGSARVGLQAVSEGLDVVFKEAGAEWRHAGCSMCLGMNPDQLAP
GERSASTSNRNFEGRQGKGGRTHLVSPQVAAATAVLGHLASPADLSAADVPTPAGV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgggtaggacactcgcggagaaggtctgggacgaccacgtcgtccggcgcgccgagggc
gagcccgacctcctcttcatcgatctgcacctgctgcacgaggtgaccagcccgcaggcc
ttcgacggcctccgcaagagcggccgcccggtgcggcggctcgacctgaccatcgccacc
gaggaccacaacacccccacgctcgacatcgacaagcccatcgcggacccggtctcccgg
gcccagctggagacgctgcgcaagaactgcgcggacttcggcgtccggctgcacccgctg
ggcgacgtcgagcagggcgtcgtgcacgtcgtcggcccgcagctcggtctgacccagccc
ggcaccaccgtggtctgcggcgactcgcacacctcgacgcacggcgccttcggcgcgctc
gcgttcggcatcggcacctcccaggtcgagcacgtgctggccacccagacgctgcccctg
gcccgcccgaagaccatggcgatcacggtcgacggcgagctgcccgagggtgtcaccgcc
aaggacctgatcctggcgatcatcgcgcggatcggcaccggcggcggccagggctacatc
ctggagtaccgcggcgaggccatcgagaagctctcgatggaggcccgcatgaccatctgc
aacatgtcgatcgaggccggcgcccgcgcgggcatgatcgcccccgacgagaccaccttc
gcctacctccagggccgcccgcacgcccccgagggcgccgactgggacgcggcggtggag
tactggaagacgctgcgtacggacgacgacgccgagttcgacgccgaggtggtcatcgag
gccgccgagctggcgccgttcgtcacctggggcaccaaccctggccagggcgcaccgctt
tccgcggccgtccccgacccggcttcgtacgaggacgcctcggagcgcttcgccgccgaa
aaggccctggagtacatgggcttggaggccgggcagccgctgcgctccatccaggtggac
accgtcttcgtgggctcctgcaccaacggccgcatcgaggacctgcgcgccgccgccgag
atcgtccgggaccgcaaagtcgccgacggcgtacgcatgctggtcgtccccggctccgcg
cgggtcggtctgcaggccgtctccgagggcctggacgtggtcttcaaggaggccggcgcc
gaatggcggcacgcgggctgctcgatgtgcctgggcatgaacccggaccagctggccccg
ggtgagcgctccgcgtccacctccaaccgcaacttcgaggggcgccagggcaagggcggc
cgcacccacctggtgtcgccgcaggtcgcggccgcgacggcggtcctgggccacctggcc
tccccggccgacctgtccgccgccgacgtccccacgcccgctggagtctga

DBGET integrated database retrieval system