KEGG   Streptomyces coelicolor: SCO6768Help
Entry
SCO6768           CDS       T00085                                 

Gene name
SC6A5.17
Definition
(RefSeq) 1-deoxy-D-xylulose-5-phosphate synthase
  KO
K01662  
1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
sco  Streptomyces coelicolor
Pathway
Thiamine metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SCO6768 (SC6A5.17)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCO6768 (SC6A5.17)
Enzymes [BR:sco01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     SCO6768 (SC6A5.17)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
7525613..7527583
Genome map
AA seq 656 aa AA seqDB search
MTILENIRGPRDLKALSEAELGELSDEIRDFLVHAVARTGGHLGPNLGVVELTVALHRVF
ESPDDRILWDTGHQSYVHKLLTGRQDFSKLRSKGGLSGYPSREESAHDVIENSHASTVLG
WADGLAKARQVQGERSHVVAVIGDGALTGGMAWEALNNIAAARDRPLIIVVNDNERSYAP
TIGGLANHLATLRTTDGYERALAWGKDVLQRTPVVGHTVYEALHGAKKGFKDAFAPQGLF
EDLGLKYLGPIDGHDIGAVESALRRAKRFHGPVLVHCLTEKGRGYEPALRDEEDHFHTVG
VMDPLTCEPLGPAGGPSWTSVFGEEIVRIGEERADVVAITAAMLHPVGLAPFAERFPDRV
WDVGIAEQHAAVSAAGLATGGLHPVVAVYATFLNRAFDQLLMDVALHRCGVTFVLDRAGV
TGVDGASHNGMWDMSVLQVVPGLRIAAPRDADQLRTQLREAVAVDDAPTLLRFPKESVGP
AVPAVDRIGGLDVLHTADRSEVLLVAVGVMAPVCLGAAELLEARGIGCTVVDPRWVKPVD
PALAPLAARHRLVAVVEDNSRAAGVGSAVALALGDAEVDVPVRRFGIPEQFLAHAKRAEV
LADIGLTPVDVAGRIAASLALAEPAGDRAGGPAVEQPGDGRMSGDGRIVMPAQGEN
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
gtgacgattctggagaacatccggggaccacgcgacctgaaggcgctgtccgaggcggaa
ctcggtgaactgtccgacgagatacgtgacttcctggtgcacgcggtcgcccgcaccggc
ggtcacctcggacccaacctcggcgtggtggaactcaccgtcgccctgcaccgggtcttc
gagtcgccggacgaccgcatcctgtgggacaccggccatcagagctatgtgcacaaactc
ctgaccggacgtcaggacttctccaagctgcggagcaagggcggcctttccggctacccc
tcgcgcgaggagtccgcgcacgacgtcatcgagaacagccacgcctccaccgtcctcggc
tgggccgacggcctcgccaaggcccgccaggtgcagggggagcgcagccacgtcgtcgcc
gtcatcggtgacggcgcgctcaccggcggcatggcctgggaggcgctgaacaacatcgcg
gcggccagggaccggccgctgatcatcgtcgtcaacgacaacgaacgctcgtacgcgccg
accatcggcggcctcgccaaccacctggcgaccctgcgcaccaccgacggctacgagcgg
gccctggcctggggcaaggacgtgctccagcgcacgcccgtggtgggccacaccgtctac
gaggccctgcacggcgccaagaagggcttcaaggacgccttcgccccgcaggggctcttc
gaggacctgggactgaagtacctcggtccgatcgacgggcacgacatcggcgccgtcgag
tcggcgctccgccgcgcgaagcgcttccacggcccggtgctcgtgcactgcctcaccgag
aagggccgcggctacgagcccgccctgcgcgacgaggaggaccacttccacacggtcggc
gtgatggacccgctcacctgcgagccgctcggcccggcgggcgggccgtcctggacctcc
gtgttcggtgaggagatcgtccggatcggcgaggagcgcgcggacgtggtggcgatcacc
gcggccatgctgcacccggtcggtctcgcccctttcgccgaacggttccccgaccgcgtc
tgggacgtcggcatcgccgagcagcacgccgccgtctccgccgccggcctcgccaccggc
ggactgcacccggtcgtcgccgtctacgccaccttcctcaaccgcgccttcgaccagctc
ctgatggacgtggccctgcaccgctgcggcgtcaccttcgtcctggaccgggccggcgtc
accggcgtcgacggcgcctcgcacaacggcatgtgggacatgtccgtcctccaggtcgtc
cccggactgcggatcgccgccccgcgcgacgccgaccagctgcgcacccagctgcgcgag
gcggtcgccgtggacgacgcgccgacgctgctgcgcttcccgaaggagtccgtcggcccc
gccgtgcccgccgtcgaccggatcggcggcctggacgtcctgcacaccgccgaccggtcc
gaggtgctgctcgtggcggtgggcgtgatggcacccgtctgcctcggggccgccgaactc
ctcgaggcccgcggcatcggctgcaccgtcgtcgacccgcgctgggtcaagccggtcgac
ccggcgctcgcaccgctcgcggcccggcaccggctggtcgccgtggtcgaggacaacagc
cgggccgccggggtcggttccgcggtggcgctggcgctcggcgacgccgaggtcgacgtc
cccgtgcgccgcttcggcatccccgagcagttcctcgcgcacgccaagcgcgccgaggtg
ctcgcggacatcggcctcaccccggtcgacgtcgccgggcggatcgccgcgagtctggcc
ctcgccgagccggccggggaccgggcgggtggaccggcagtggaacagcccggcgacgga
cggatgtccggcgacggacggatcgtcatgccagcgcaaggagagaactga

DBGET integrated database retrieval system