KEGG   Saccharophagus degradans: Sde_2654Help
Entry
Sde_2654          CDS       T00335                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sde  Saccharophagus degradans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sde_2654
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Sde_2654
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sde_2654
Enzymes [BR:sde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Sde_2654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3363402..3365768
Genome map
AA seq 788 aa AA seqDB search
MKRRDFIKVASTTVSGMLGTVVTPSTAALQAAKRPNLAALSPVDPIPNNEQRNWLGKAYW
GNRLQDWQVNNGRIECLRAEASFEVRTVALLTRALNNAHKPARLRMHLGNLTPSKNGFCG
FLLGIGAGKLDYRACALAQRYGGENGGFMAVIDSSGELSFRDFSNQNKPIAYEQLQRTTH
SQTKKPLADKDIILDCHIDPTDQATFDVRLIASDAKTGEELGFIVRTQVPASELLGGIAM
LSSPPAKQAGARWWFNRIETGGEKISINEEHALGPVMGCLYSLNKSVLKLTAQFLPIANP
HKKHVRLEYKAAKDNTWKQGQTKPIEDGYVACFRLSKWDFSQAYEYRIVFTDAPNTALFC
GTIVKDHQSSKQLNIALYSCIIPTAKSLDREVYEKLIPQEAILGRYTPDNILFPHNKLVT
HCDSHAPDLYVFAGDQYYETYPTRYGRDTPDAKLDTLYRWYLWFWTFRDSVRHRPAIVIA
DDHDVLQGNLWGNGGKDSSDNTEEGGGFSWAKDLVRMVYRIQHSHNPDAFDPTPIKHDIP
VTYGEFEYGGVSFAIIEDRKFKTPPNTEVDPLLTKGELLGKRQEDFLKHWSENNTHLPKI
CLTASMWGSPQTKGNAEPLLDYDANGYPPDGRTRAVSLVKRANALVLAGDQHLAMVAKQG
VNDYEDGALFFAGPAAAAFWQRWFEGEGKLENKRNNHPNTGNFIDTFGNKMRVLAVANPK
LTYAEFKASNKHWGNFVADHRLKSEGYGIVKVDHTKKQYTLECWPWDVDPNTGAQFEGWP
FVKKWQDR
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagacgagattttattaaagtagcctccacaactgtctctggaatgctaggtaca
gttgttacacccagcacagccgctttacaagctgcaaagcggcccaacttagcagcgctt
tcacccgtagaccccataccaaacaatgagcagcgcaattggctgggtaaagcttattgg
ggtaacagattacaagactggcaagtaaacaacggcagaatagaatgccttcgcgcagag
gcgagctttgaagtgcgcactgttgccctgttaactcgcgccctaaacaacgcccacaaa
cccgcccgcttacgcatgcatttgggtaatctcaccccgtctaaaaatggtttttgcggc
tttttattgggtataggtgcaggtaagttagattaccgcgcatgtgccttagcccagcgt
tacggcggggaaaacggcggctttatggcggtaattgatagctccggcgaacttagcttt
cgcgactttagcaaccaaaacaagccaatagcttacgagcagttacaacgcaccactcat
agccaaactaaaaaaccgctagccgataaagacattattttagattgccatatagaccca
accgaccaagcaacgtttgatgtgcgcttaatagcaagcgacgccaaaactggcgaagag
ctcggttttattgtaagaacccaggttccagcctccgaactactaggcggtattgcaatg
ctttcctcaccgccagccaaacaagctggcgcacgctggtggtttaatcgcatagaaact
ggcggagaaaaaataagtattaacgaggaacatgcacttgggcctgttatgggctgtttg
tacagcttaaataaatcggttttaaaattaactgcgcagtttttacctatcgcaaatcca
cacaaaaaacatgttcgcttagagtacaaggcagcgaaggataacacctggaaacagggt
caaacaaaacccatagaagacggttatgtagcctgcttcagactgagtaagtgggatttc
tcgcaagcctatgagtatcgaatagtatttaccgacgcgcccaataccgcgctgttttgc
ggcacaattgttaaagatcatcaatcaagcaaacagctaaatattgcactttattcatgc
attattcccacagcgaaaagtttagatagagaagtttacgaaaaactcattccacaggaa
gccattctagggcgctatacgcccgataatattttattcccccacaacaaactggtaaca
cattgcgatagtcacgcaccggacctgtatgtatttgctggcgatcaatattatgaaacc
taccccacccgctatggccgcgatacacctgacgcaaaattagataccctataccgttgg
tatttgtggttttggactttccgcgattcggtaagacacaggcccgccatcgtaatcgcc
gacgatcacgatgtgttacaaggcaacctatggggcaacggcggtaaagattctagcgat
aacaccgaagaaggcggcggctttagctgggcaaaagatttagtacgtatggtctatcgc
attcaacattcccacaaccctgatgcgtttgaccccacacccattaaacacgacattccc
gttacctacggcgaattcgagtacggcggtgtaagcttcgccattatagaagatagaaaa
tttaaaaccccgcccaataccgaagtggacccattactcaccaaaggcgagctgttgggt
aaacgacaggaagattttctgaagcactggagcgaaaacaacactcacctaccaaaaata
tgtttgactgcatccatgtgggggtcgcctcaaaccaaagggaatgccgagcctctgcta
gattacgatgccaacggctacccaccggatggccgtacacgcgccgtaagcttagttaaa
agagccaacgcactagtattagcaggcgaccaacatttggcaatggttgctaaacaaggc
gtgaatgattacgaagatggagcattattttttgcaggccctgccgccgccgcgttttgg
caacgctggtttgaaggtgaaggcaagctagaaaacaaacgtaacaatcaccctaacacc
ggtaattttattgatacttttggcaataaaatgcgtgtactcgcggttgccaaccccaaa
ttaacttacgcagaatttaaagccagtaacaagcactggggtaattttgttgccgatcac
cgcttaaaaagtgaaggttacggaatagttaaagtggaccacactaaaaagcaatatacg
cttgagtgttggccgtgggatgtggacccgaataccggagcacagtttgaaggctggcct
tttgtgaaaaagtggcaagacagatga

DBGET integrated database retrieval system