KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_07650Help
Entry
SDE12394_07650    CDS       T02017                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
sdg00010  Glycolysis / Gluconeogenesis
sdg00260  Glycine, serine and threonine metabolism
sdg00680  Methane metabolism
sdg01100  Metabolic pathways
sdg01110  Biosynthesis of secondary metabolites
sdg01120  Microbial metabolism in diverse environments
sdg01130  Biosynthesis of antibiotics
sdg01200  Carbon metabolism
sdg01230  Biosynthesis of amino acids
Module
sdg_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sdg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDE12394_07650 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SDE12394_07650 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SDE12394_07650 (gpmA)
Enzymes [BR:sdg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SDE12394_07650 (gpmA)
Membrane trafficking [BR:sdg04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SDE12394_07650 (gpmA)
Exosome [BR:sdg04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SDE12394_07650 (gpmA)
  Exosomal proteins of melanoma cells
   SDE12394_07650 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADX24976
Position
complement(1493339..1494034)
Genome map
AA seq 231 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTR
AIKTTNLALENAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPAMAKDDEYSAHKDRRYADLDPALIPDAENLKVTLERAMPYWEEKIAPALLDGKNVFVG
AHGNSIRALVKHIKGLSDDEIMDVEIPNFPPLVFELDEKLNIVKEYYLGGE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggttttcgctcgccacggtgagtcagaatggaacaaagctaacctcttc
actggttgggcagatgttgatctttcagaaaaagggacacaacaagcgattgatgcaggt
aaattgatcaaagaagcaggtattgaatttgaccttgctttcacttcagtattgacacgt
gctatcaaaacaactaaccttgcccttgaaaatgcaggtcaattgtgggttccaactgaa
aaatcatggcgcttgaacgagcgtcactatggtgctttgactggcaaaaacaaagctgaa
gctgcagaacaatttggtgatgaacaagttcatatctggcgtcgttcatacgacgtattg
ccgccagctatggctaaagatgatgagtattcagcacacaaagaccgtcgttatgctgat
cttgatccagctcttatcccagatgctgaaaacttaaaagtaactcttgaacgcgcaatg
ccttactgggaagaaaaaattgctccagctcttcttgacggtaaaaacgtctttgttggc
gcacacggtaactcaatccgcgctcttgttaaacacattaaaggtctttcagatgacgaa
atcatggatgtggaaattccaaacttcccaccacttgttttcgaattggatgaaaaactt
aacattgttaaagaatactacctcggtggtgaataa

DBGET integrated database retrieval system