KEGG   Staphylococcus pseudintermedius ED99: SPSE_0186Help
Entry
SPSE_0186         CDS       T02008                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SPSE_0186 (rbsK)
Enzymes [BR:sdt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SPSE_0186 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
220046..220930
Genome map
AA seq 294 aa AA seqDB search
MRQIYVIGSMSMDLVVSSQVVPEQGETVLGEDFFTTPGGKGANQAVAAARLGEQVHMIGC
VGEDTFGEQIQQNFKDNGVQIDGIEVIEGESSGTAHITLSQQDNRIIVVPSANGYVTPER
IQPYLARMEAGDIVLIQQEIPAETVAHVIDYCAQHDIVSILNPAPYREVPAKVIEQAHYI
TPNETESAHLFKGEAIEEVAAQYPNKLIVTLGSEGAMYHNGVQIVKVPSFKRTVKDTTGA
GDTFNGALAVGLQKDYSLTKAIEFANLAASYSVTGMGAQGGMPYFADLERELGV
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaaatttatgtcattggaagtatgtctatggatttagtggtatcttcacaggtg
gtaccagaacaaggtgagacagtgttaggtgaggacttctttacaacacctgggggcaaa
ggtgcgaaccaagctgttgccgcagcacgtctcggtgaacaagtgcatatgatcggttgt
gtcggtgaagatacattcggtgagcaaattcaacaaaactttaaagacaatggtgtgcaa
atagatggcattgaagtgattgaaggtgaatcatctggaacagctcatattacattatca
cagcaagacaatcgcataatcgttgtgccatcagcaaatggttatgtgacaccagaacgg
attcagccgtacttagcgcgtatggaagcgggagatattgtgctgattcaacaagaaatt
ccagcagaaacagtcgcacatgtgatagattactgtgcgcaacatgatattgtatctatt
ttaaatcccgcaccttatcgtgaagtgcctgcaaaagtcatcgaacaagcgcattatatt
acgcctaatgaaacggaaagcgcgcatctatttaaaggtgaggccattgaagaggtcgcg
gcacaatatccaaataaactcattgtgacacttggttcggagggggcaatgtatcataac
ggcgtacaaatcgttaaggtcccaagcttcaaaagaacggtcaaagatacgacgggtgca
ggagatacgtttaatggcgccttggcagtcggattacaaaaagattattcgttaactaaa
gcgattgaatttgccaacttagcagcaagttattcagtaacaggtatgggtgcacaaggt
ggcatgccgtattttgcggatttggaacgtgaattaggtgtatag

DBGET integrated database retrieval system