KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_1509Help
Entry
SPC_1509          CDS       T00862                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPC_1509 (folE)
Enzymes [BR:sei01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SPC_1509 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1579587..1580255
Genome map
AA seq 222 aa AA seqDB search
MPSLSKEAALVHDALVARGLETPLRPPMDELDNETRKSLIAGHMTEIMQLLNLDLSDDSL
METPHRIAKMYVDEIFAGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDG
KATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILTALQTLLGTNNVAVSIDAVH
YCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHP
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgccatcactcagtaaagaagcggccctggttcatgacgcgctggttgcccgggggctg
gaaacgccgctgcgcccgcctatggatgaactggataatgaaacgcgaaaaagccttatc
gcagggcatatgactgagattatgcagttgctgaatctcgatttgagcgatgacagtctg
atggaaacgccgcatcgtatcgctaagatgtacgttgacgagattttcgccggcctcgac
tatgctaatttcccgaaaattaccctcattgaaaataaaatgaaggtggatgaaatggtc
accgtccgcgatatcacgctgaccagcacctgtgaacatcactttgtgaccattgatggc
aaagcgaccgtcgcgtatatccccaaagattccgtgatcggcctgtcgaaaattaaccgc
atcgtgcaattcttcgcccagcgtccgcaggttcaggaacgtttgacccaacaaattctg
acggcgctgcaaaccttgctcggcaccaataatgtagcggtatcgattgatgcggtgcat
tactgcgtgaaagcgcgcggtattcgtgacgcaaccagcgccacgacgacgacgtcgctg
ggcggattgtttaagtccagccagaatacgcgccaggagtttctgcgtgccgttcgccat
catccatga

DBGET integrated database retrieval system