KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_0239Help
Entry
SPUL_0239         CDS       T01740                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sel00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPUL_0239 (dxr)
Enzymes [BR:sel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SPUL_0239 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
259707..260990
Genome map
AA seq 427 aa AA seqDB search
MYKAPRRRHYQVSCAAFCFLFRFNTSGRFMKQLTILGSTGSIGCSTLDVVRHNPDSFRVI
ALVAGKNVARMAEQCLEFSPRYAVMDDTSSAEQLKIMLQQHGSRTEVLSGQQAACEMAAL
DEVGHVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDEVKRSNARLLPVDS
EHNAIFQSLPQSIQHNLGYADLEQNGVTSILLTGSGGPFRETPMCDLAAMTPDQACRHPN
WSMGRKISVDSATMMNKGLEYIEARWLFNASARQMEVLIHPQSVIHSMVRYQDGSVLAQF
GEPDMRTPIAHTMAWPNRVTSGAQPLDFCKLSALTFSAPDYQRYPCLKLAMEAFEQGQAA
TTALNAANEITVAAFLAQQIRFTDIAGLNLAVLERMDLHEPASVDDVLQVDAIAREVARK
QVIRLSR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgtacaaagcgccgcgcagaagacattatcaggtctcctgtgcggcgttttgcttttta
ttccgtttcaacacttctggacgtttcatgaagcaattaaccattctgggctcgaccggc
tctattggttgcagcacactggacgtggtgcgccataatcctgatagcttccgcgttatc
gcgctggtggcgggtaaaaatgttgcccgcatggcggagcagtgcctggagttctcgccg
cgttatgccgtgatggacgatacgtcgagcgcagaacagctcaaaataatgcttcagcag
catggcagccgcaccgaggttctgagcggtcagcaggctgcctgtgagatggcggcgctt
gatgaggtcgggcatgtgatggcggccattgtgggcgcggctggtttactgccgaccctg
gcggcgattcgcgcaggaaagacgattctgctggcgaataaagaatcgctggtgacctgc
gggcggctgtttatggacgaagtaaaacgcagcaacgcccggcttttacccgtcgatagc
gaacataacgcgatttttcagagtttgccgcaatctattcagcataatctgggatacgct
gaccttgagcaaaatggcgtaacgtcgattttgcttaccgggtctggtggcccgtttcgt
gaaacgccaatgtgcgatctggcagcgatgacgccggatcaggcatgtcgtcatccgaac
tggtcgatggggcgaaaaatctccgtcgactccgccaccatgatgaataaaggtctggaa
tacattgaagcgcgttggttatttaatgccagcgcacgtcagatggaagtgttgatccat
ccgcaatcggtcattcattcgatggtgcgttatcaggacggcagcgtcctggcgcagttt
ggagaacctgacatgcgtacgcctattgcgcatacgatggcatggccgaatcgcgtcacg
tccggcgcgcagccgcttgatttttgcaaactcagcgcgctgacgtttagcgcgccagat
tatcagcgttatccgtgcctgaagctggcgatggaggcgtttgagcaaggtcaggcggca
acgacggcgctcaatgcggcaaacgaaatcaccgttgccgcgtttctggcgcaacagatt
cgttttaccgatatcgccgggctcaatttagcggtgctggagaggatggatttacacgaa
ccggcaagcgttgatgacgtattgcaggttgacgccatcgcgcgtgaagtagccagaaaa
caagtgatacggctctcacgctga

DBGET integrated database retrieval system